KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_3283
Entry
ECIAI39_3283      CDS       T00829                                 

Gene name
xdhC
Definition
(RefSeq) xanthine dehydrogenase subunit XdhC
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
ect00230  Purine metabolism
ect01100  Metabolic pathways
ect01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ect00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECIAI39_3283 (xdhC)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-GeneID: 7153176
NCBI-ProteinID: YP_002409206
UniProt: A0A0H3MKE6
Position
3430775..3431254
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcaccaggcacgccgctctcggaattactccgcgaacaaggactgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgctggtcgacggcacagca
atagacagttgcttataccttgccgcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggaaaactttctcatgttcagcaggcttatgcgaaatccggcgca
gtgcagtgcgggttttgtacgcctggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgcggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system