KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_3668Help
Entry
ECIAI39_3668      CDS       T00829                                 

Gene name
argG
Definition
(RefSeq) argininosuccinate synthase
  KO
K01940  argininosuccinate synthase [EC:6.3.4.5]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
ect00220  Arginine biosynthesis
ect00250  Alanine, aspartate and glutamate metabolism
ect01100  Metabolic pathways
ect01110  Biosynthesis of secondary metabolites
ect01130  Biosynthesis of antibiotics
ect01230  Biosynthesis of amino acids
Module
ect_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:ect00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECIAI39_3668 (argG)
   00220 Arginine biosynthesis
    ECIAI39_3668 (argG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ect04147]
    ECIAI39_3668 (argG)
Enzymes [BR:ect01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     ECIAI39_3668 (argG)
Exosome [BR:ect04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECIAI39_3668 (argG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginosuc_synth QueC
Motif
Other DBs
NCBI-GeneID: 7150594
NCBI-ProteinID: YP_002409571
UniProt: B7NKP0
Structure
PDB: 

Position
3828401..3829744
Genome map
AA seq 447 aa AA seqDB search
MTTILKHLPVGQRIGIAFSGGLDTSAALLWMRQKGAVPYAYTANLGQPDEEDYDAIPRRA
MEYGAENARLIDCRKQLVAEGIAAIQCGAFHNTTGGLTYFNTTPLGRAVTGTMLVAAMKE
DGVNIWGDGSTYKGNDIERFYRYGLLTNAELQIYKPWLDTDFIDELGGRHEMSEFMIACG
FDYKMSVEKAYSTDSNMLGATHEAKDLEYLNSSVKIVNPIMGVKFWDESVKIPAEEVTVR
FEQGHPVALNGKTFSDDVEMMLEANRIGGRHGLGMSDQIENRIIEAKSRGIYEAPGMALL
HIAYERLLTGIHNEDTIEQYHAHGRQLGRLLYQGRWFDSQALMLRDSLQRWVASQITGEV
TLELRRGNDYSILNTVSENLTYKPERLTMEKGDSVFSPDDRIGQLTMRNLDITDTREKLF
GYAKTGLLSSSAASGVPQVENLENKGQ
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgattctcaagcatctcccggtaggtcaacgtattggtatcgctttttccggc
ggtctggacaccagtgccgcactgctgtggatgcgacaaaagggagcggttccttatgca
tatactgcaaatctgggccagccagacgaagaggattatgatgcgatccctcgtcgtgcc
atggaatacggcgcggagaacgcacgtctgatcgactgccgcaaacaactggtggccgaa
ggtattgccgctattcagtgtggcgcatttcataacaccactggcggcctgacctatttc
aacacgacgccgctgggccgcgccgtgactggcaccatgctggttgctgctatgaaagaa
gatggcgtgaatatctggggtgacggcagcacctataaaggaaacgatatcgaacgtttc
taccgttacggtctgctgaccaatgctgaactgcagatttacaaaccgtggcttgatact
gactttattgatgaactgggcggccgtcatgagatgtctgaatttatgattgcctgcggt
ttcgactacaaaatgtctgtcgaaaaagcttactccacggactccaacatgcttggtgca
acgcatgaagcgaaggatctggaatacctcaactccagcgtcaaaatcgtcaatccaatt
atgggcgtgaagttttgggatgagagcgtgaaaatcccggcagaagaagtcacagtacgc
tttgagcaaggtcatccggtggcgctgaacggtaaaacctttagcgacgacgtagaaatg
atgctggaagctaaccgcatcggcggtcgtcacggcctgggcatgagcgaccagattgaa
aaccgtatcatcgaagcgaaaagccgtggtatttacgaagcccctgggatggcactgctg
cacattgcgtatgaacgtttgttgaccggtattcacaacgaagacaccattgagcagtat
cacgcgcatggtcgtcagttgggccgtctgctgtaccagggacgttggtttgactcccag
gcgctgatgctgcgtgactctctgcaacgctgggttgccagccagatcactggtgaggtt
accctggagctgcgccgtgggaacgattattcaatcctgaataccgtctcagagaacctg
acctacaagccagagcgtctgacgatggaaaaaggcgactcggtgttctcgccagatgat
cgtatcggtcaactgaccatgcgcaacctggatatcaccgatacccgcgagaaacttttc
ggttatgccaaaactggcctcctctcctcctctgccgcttcgggcgtgccacaggtggag
aatctggaaaataaaggccagtaa

DBGET integrated database retrieval system