KEGG   Encephalitozoon cuniculi: ECU07_1500
Entry
ECU07_1500        CDS       T00105                                 

Name
(RefSeq) CATION-TRANSPORTING ATPase
  KO
K13526  cation-transporting P-type ATPase 13A2 [EC:7.2.2.-]
Organism
ecu  Encephalitozoon cuniculi
Brite
KEGG Orthology (KO) [BR:ecu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ECU07_1500
SSDB
Motif
Pfam: E1-E2_ATPase Hydrolase P5-ATPase Cation_ATPase Hydrolase_3
Other DBs
NCBI-GeneID: 859511
NCBI-ProteinID: NP_586078
UniProt: Q8SRH4
Position
VII:complement(173167..176607)
AA seq 1146 aa
MKPLKMFVGIKQEKPFISVEGRKRRISTGFYNVLCVLTLGGFHMVCRYLPKVKHFLLSSP
CSLSDADCVIVTSQNGRREFVDVLAYSTEEIPSLRRYSLEGKARVVDSLFSRLIYDVVSR
RFVVPPEQKAVFRDFEELYSTEISKSPETERAEAIQRNIFYGRNVTSLPIPGVFDIVVKN
TLNITFLSNIICLFVWRAVDYHNYAFVMGMLMLYSFVFTNWEEISHSIGMKKLVKRRTVK
ILRGGRFVEVDSREVYPGNIIYIEPCKEFPCDALVIRGDAITNECLLTGETVPIYKNADQ
LSVVYSGTDVLKSISTIPMSTNLRNENLCRVRSLTSKNRSRAAGMVGSIDVLGNSAVGMV
LRTGFQTTRGQILKNMLNAKPVHNRFIREAEIIILGIVMVAMAVGIGMAYVLNKMGFDAS
TNLMYSLDLFFTFANPAIPTYLRVGTQLCYKKLIKKNIYCSNLNKIHLAGRIDTAVFDKT
GTLTCEGLDLLCIDDLNRPVDDINKVAMVTRLGLSTCHLVYELDGRYSGDTLDLKMFIFS
SSKLVQHENTRSVVIGGHNRIYGPILKEYNDSEEMVYYQKDRTHGGRFADIDGNADEEDK
DLSPVLLDVDEGAKFNLSDECGEGQDGEINAVIMKTYEFDSNIRRMSVVVDDGDRKYVFT
KGSPESIQEILKERPRGYEEKAKEYSLGGYRVISLAYKEISESADRASDESEMKFLALIV
FSNKLKENSRRTVDELNKANIRNIMCTGDNILTAISVGKECRIVEEFVPVIFPVLEENAK
SIFDVDWLCVGDEEEFTFDKVRLSLYRGNDRVSNNEFVVACEGREFDFFRNTHYFEFILE
KGAIFARFNPGQKKALIENLRASGKITMFCGDGANDSGALSSADVGLALGQNEASLAANF
TSSEISSVLDLIKEGRSAFVTSTATFKYVVSYCAIAYVVLVFLVLRKKFLSDLQTIHGDL
LVSIPIAYMLTCFDASDKLFPSPPDTFLLPKKDFVPFCLTIALECLVLWILSLYGEPCPE
ISTQSITAELMFFVSTFIYIFNALYLSDCSPHRQSLKDNVLFKTFISFMILSTIAFLMVV
YLFPEWTFLWLRGYNFVETDGFEIGLVLISAFSVTIAVFVVQPLVGRMLGDKSMQDMVPS
KPEEKI
NT seq 3441 nt   +upstreamnt  +downstreamnt
atgaagcccttgaaaatgtttgtgggaatcaagcaggaaaagccgtttataagcgtcgag
ggaaggaaaagaagaatatctacaggcttctacaacgtcctctgtgtgctgaccctggga
gggttccatatggtgtgcagatatctacccaaggtcaaacattttctactcagttcgccc
tgcagcctttctgatgcagactgtgtcatagtaacatcacagaacgggagaagagagttt
gttgatgttcttgcttactccacggaggagattccctcgctcagaaggtattcgttggaa
gggaaggcccgtgtggttgattccctgttttctagactcatatacgatgttgtttccagg
aggtttgtggttcctccggagcagaaggcggtgttcagagactttgaggagctttacagc
acagagatttcaaagtctcccgagacggaaagggcagaagccatacaaagaaacatattc
tacggaaggaatgtcacaagccttccgattccgggtgttttcgacatagtcgtgaagaac
actctgaacatcacgtttttatcgaatataatatgtctgtttgtatggagggccgttgac
taccacaactatgcatttgtgatggggatgctcatgctgtactcgtttgtatttacgaac
tgggaggagatttcccactctatcggcatgaagaagcttgtgaaaaggcgaacggttaaa
atacttcggggaggaaggtttgtggaggtggacagccgggaggtatatcccggaaacata
atttacattgagccgtgcaaggagttcccgtgcgatgcccttgtgatcaggggagatgcc
ataacaaatgagtgcctccttaccggagagactgttccgatatacaaaaatgccgaccag
ctttctgttgtgtactcgggaacggatgtcttgaagagtatcagcaccatacctatgtcc
actaacttaagaaatgagaatctctgcagagtcaggagccttaccagcaaaaatagatcg
agggcagctggaatggtgggctccattgatgtccttgggaactctgctgttgggatggtt
ctcagaacagggttccagaccacccgggggcagatcttgaagaatatgcttaatgcaaag
cctgttcacaacagatttatcagagaggctgagataattattctaggaattgttatggtt
gcgatggctgttgggatcgggatggcgtatgtgctcaacaagatgggatttgatgcaagt
acgaatcttatgtacagccttgatctgttttttacgtttgcgaatccagcgattcccacg
tatctaagggtcgggacccagctgtgttacaagaagctaatcaaaaagaacatctactgt
agcaatctgaataagattcatctggcagggagaatagacacggcggtgtttgacaaaaca
ggaacgctaacgtgtgagggtcttgatcttctctgcattgatgatcttaataggcctgtg
gacgatatcaacaaagttgccatggtaaccaggctcgggttgagtacatgccatttggtc
tacgagttggatggaaggtattccggagatactctcgacctgaagatgtttattttctct
tcctctaagcttgttcagcacgaaaacacaagaagcgtggttattggaggccataatagg
atctacgggcccatcctgaaagagtataatgacagcgaggagatggtatattaccagaaa
gacaggacccacggaggccgatttgctgatattgatgggaatgccgatgaagaagataag
gatctttctcctgttcttcttgatgttgacgaaggcgccaagttcaatctgagcgacgaa
tgtggagaaggacaggacggcgagatcaatgcagtgattatgaagacctatgagtttgac
tcgaacatcaggaggatgagtgtagtggtggatgacggagatagaaagtacgtatttaca
aaggggtctcccgagtcgattcaggagattctaaaggagaggccacggggatatgaggag
aaggccaaggagtattccttgggtgggtatagagtgatatcactggcatacaaggaaata
agtgaaagcgccgatagagcttccgatgagtctgagatgaagtttcttgcccttatagtg
ttctcgaacaagctcaaggaaaactcaagaagaactgttgatgagctcaataaggcgaat
ataaggaacatcatgtgcaccggggacaacatactgacggctatatctgtggggaaggag
tgcaggattgtggaagagtttgttcctgtgatattccccgttcttgaggaaaatgcgaag
tccattttcgatgttgactggctctgtgttggggacgaggaggagtttacctttgataag
gtaaggctaagtctgtacaggggaaatgacagggtctctaacaacgagtttgttgttgca
tgcgaaggaagggagtttgacttcttcaggaatacccactattttgagtttattcttgag
aagggggccatatttgctagattcaatcccggacaaaagaaggccctcatagaaaatctt
agggctagtgggaagatcacgatgttctgcggggacggtgcaaacgatagcggggctctc
agcagtgctgatgttggcctggccttgggacagaatgaggccagcctggcagccaacttt
acctcctctgaaataagttctgttctagacctgatcaaggaagggcgatcggcctttgtg
acatccacggccacgtttaaatatgttgtctcctactgcgccattgcatatgtggtgctt
gtcttccttgttctcagaaagaagtttctaagtgacctgcagacgatacatggagacctg
ctcgtctcgattcctatcgcatacatgctaacatgctttgacgcatctgataagctgttt
ccaagccccccagacacattcctgcttcccaaaaaggactttgtgcccttctgcctgacc
atagccctcgagtgtttggtcctctggattctgtctctgtatggcgagccctgccctgag
ataagtactcaatctatcacggctgagctcatgttttttgtcagtacgttcatctacatt
ttcaatgccttgtatctgagtgattgctctccgcatagacagagcctaaaagataacgtg
ctgtttaagactttcatttctttcatgatcttgtcaactatagcttttttgatggtagtg
tatctctttccggagtggacgtttctgtggttgcggggatacaattttgtagagaccgat
gggtttgagataggactggttctcatttctgccttctctgttactattgcagtgtttgtg
gtccagcccttggtgggcagaatgcttggcgataagagtatgcaagacatggtccctagc
aagcctgaagaaaagatataa

DBGET integrated database retrieval system