KEGG   Encephalitozoon cuniculi: ECU08_0410Help
Entry
ECU08_0410        CDS       T00105                                 

Definition
(RefSeq) HISTONE H2B
  KO
K11252  histone H2B
Organism
ecu  Encephalitozoon cuniculi
Brite
Chromosome and associated proteins [BR:ecu03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    ECU08_0410
Exosome [BR:ecu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ECU08_0410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histone CENP-S CBFD_NFYB_HMF TFIID_20kDa
Motif
Other DBs
NCBI-GeneID: 859592
NCBI-ProteinID: NP_597170
UniProt: Q8SRE2
Position
VIII:complement(51850..52242)
Genome map
AA seq 130 aa AA seqDB search
MAKSARHVTGKAPSSLDAHDRKKSKKKSSSMCVGSMFKSAVKRISREVSPDNNIMLTSNS
IQVLCGISYDFVDTVADLAGELARKVGKQTVGSDDIISAFEILLKGELRKLAIREVHNAL
SKSQAKSRGK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtctgcacggcatgttacaggtaaggcaccatcgtctctggatgcacacgat
aggaagaagtccaagaagaagtcgtcgtccatgtgtgtgggcagcatgttcaagtctgca
gtcaagcgtatttcccgggaggtcagtccagacaacaacatcatgctgacaagcaattcc
atccaggttctttgcggaatctcatacgactttgttgatacagttgccgatcttgctggt
gagctagcaaggaaggttgggaagcagacggtggggtctgacgacatcataagtgcattt
gagatcttactcaagggagagctgcgaaaacttgccatcagagaggtccacaacgccctt
tccaaaagccaagctaagtctcgtggaaaataa

DBGET integrated database retrieval system