KEGG   Encephalitozoon cuniculi: ECU09_1640Help
Entry
ECU09_1640        CDS       T00105                                 

Definition
(RefSeq) ATP-dependent RNA helicase
  KO
K12614  ATP-dependent RNA helicase DDX6/DHH1 [EC:3.6.4.13]
Organism
ecu  Encephalitozoon cuniculi
Pathway
ecu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ecu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    ECU09_1640
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ecu03019]
    ECU09_1640
   03036 Chromosome and associated proteins [BR:ecu03036]
    ECU09_1640
Enzymes [BR:ecu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     ECU09_1640
Messenger RNA biogenesis [BR:ecu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     ECU09_1640
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     ECU09_1640
Chromosome and associated proteins [BR:ecu03036]
 Eukaryotic Type
  Gene silencing
   piRNA pathway
    ECU09_1640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C ResIII CMS1
Motif
Other DBs
NCBI-GeneID: 860503
NCBI-ProteinID: XP_955717
UniProt: Q8SQK9
Position
IX:189451..190920
Genome map
AA seq 489 aa AA seqDB search
MPMKSMIEGVKKDGKKGRRNDRKDSWDKDGFTQRGRAEKKPVDLAKIQGIQGQIGIGKNK
GDGNRLDCGMDKEEAEDGKDIMRCRHLSPGGGGMKRLLSEDVRETEGIGWESLGLGPVLL
KRIRDIGYDFPSPVQVASIPHVLGGKNLLVRSKNGTGKTASYIVPMLNMINSSELSIQGI
ILVPIRELALQISRNVKRMSEGTGVISAPVVGGTSMQDDIIRVSNGVHVMVGTPGRIVDL
VEKRVGTLSKRVILVFDEADKLLDVTFGETVTKLLDLLPREKQMLLYSATFPYFVTGFIR
RYMKNPLCINLMKELAPVGVKQFYTYVKPSEKLLCLKSLLLRLSINQCVIFCNSIKTVEL
LAMKITEMGLPSYFIHSKMAQEDRNIVFHNFLKGKCKILVATDLITRGVDAPNTNYVINF
DISKSPESYLHRIGRAGRFGAPGVAISLVTTEEKEMLMDIEAKLGKEISPLSDKGLSRLH
ESNIDRNQG
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgaaaagcatgatcgaaggcgtgaagaaggatgggaaaaaagggagaaggaat
gatcggaaagactcttgggacaaggatggcttcacacagagagggcgtgcagaaaagaag
cctgttgatctagctaagatacaaggaattcagggtcagataggaataggaaaaaacaag
ggagatggcaatcgtctcgattgtgggatggacaaggaggaggcagaagatggcaaggac
atcatgcgctgcaggcacctttctccgggaggaggtggcatgaagaggttgctgtcggag
gatgtaagagaaacagagggcataggatgggagtcacttggactcgggccggtgctgctg
aaaagaatacgcgatattggctatgactttccatcgcctgtccaggtggcatcgattcca
catgtcctaggaggaaagaacctgttggtcagatcgaagaatggaaccggaaagacagca
tcttacatagttcccatgctcaacatgataaattcctcagagctgagcatccagggaatc
atattggtacccatcagagagcttgctctacagatatcaagaaatgtcaaaagaatgtct
gagggcactggggtgatatctgcgcctgtggttggagggactagcatgcaggacgacatc
ataagggtgtccaatggtgttcacgtgatggtgggaacgccaggaagaattgtggacctg
gttgagaagagggttgggacgctttcgaaaagagtgatcttggtgtttgatgaggccgac
aagctgcttgatgtgacatttggagagactgtcacaaagcttctagatctgcttccaagg
gaaaagcagatgctactgtactctgcaacctttccttattttgttaccgggtttatcaga
agatacatgaagaacccgctatgcattaatctgatgaaggagctcgctcccgtaggagtt
aagcagttctatacatatgtgaagccctctgaaaagcttctatgcttgaagtcccttctc
ttgagactaagcatcaaccagtgtgtgatcttctgcaatagcatcaagactgtggagctt
cttgccatgaaaattaccgagatggggcttccttcgtacttcatccactcgaagatggct
caggaagacaggaatatagtgtttcacaacttcctgaaagggaagtgtaagattctggtt
gcaactgacctcatcacacgtggagtggatgctccaaacacaaactacgtaatcaacttc
gacatttctaagtctcccgagtcctatcttcacaggattggacgggctggaaggtttgga
gcccctggagttgcaataagtttggttaccacggaagaaaaggaaatgctgatggacata
gaggcaaagcttgggaaagaaatatctcctctttcggataagggtctgagccgcttacat
gaaagtaacatagacaggaatcaaggataa

DBGET integrated database retrieval system