KEGG   Encephalitozoon cuniculi: ECU11_1340
Entry
ECU11_1340        CDS       T00105                                 

Definition
(RefSeq) ABC TRANSPORTER-LIKE PROTEIN
Organism
ecu  Encephalitozoon cuniculi
SSDB
Motif
Pfam: ABC_tran AAA_28 AAA_29 SMC_N AAA_16 RsgA_GTPase AAA_22 AAA_18
Other DBs
NCBI-GeneID: 860094
NCBI-ProteinID: NP_586440
UniProt: Q8SQU5
Position
XI:complement(169177..170925)
AA seq 582 aa
MKQHTLQLEGVTLDVPNQNLSSNEKYARLINGLTADFKSGNVYAFMGTSGSGKTTTLETI
AGLVPSGSRTGGRILVDGQERNPDEFPYEFAYGDQLGYIIDELTVEEFVYYYVVSSLPEE
SKERVREKMDEVLENLLNIGHIRHNKMKNISGGEQKRANLARTFTKMLLLEGELKVVLLD
EPTSELDAGLALKLGEFLRDYARRSNSIVLVTVHQPGAELYNTFDNLLFMNNGEKLYLGP
SRDFIKFLGTKGIHNDGGPETNMEFLFSLFTKGSKMSKKYEKQLEQIAKEMNEEKKEEKK
LRTSDDTEINFIPNLYVSFQMAIRQIIIDWRNREILYSLAMPIAMALFLVTGKYIYKDFS
IATIKASMLSLSLYYVMNPSGLMNDKHYVTEESNRKLYGAAEVWFSSLISDTLVSILKYC
IFFGIIYAFGLISMDHAFLGQVLMYTLGGTVSSMLFRSMASPLSTLGKVFNTTMVLMFQL
SGALLGAGALLGALTLWISVIPEGSIPQEEIDAFISNFFDSTGSTGSTSIFSKVGSWVIR
FICLVPKVVRSFLRILFLMFHPFAFFHSSILDAEKSSYKLFF
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgaaacagcacacacttcaattagaaggagtaactcttgatgttccgaaccagaacttg
tcctccaacgagaaatatgctaggctaattaatggtctgactgcagactttaagtctggg
aatgtgtatgcattcatggggaccagtggaagcggaaagacaacaacgttggagaccatt
gcaggactagtcccgagcggatccagaacaggaggaagaatcctggtagacgggcaagaa
agaaatcctgatgagtttccttatgaatttgcatatggagaccagctgggctacatcatt
gacgaactgactgttgaagagtttgtctactactatgtagtatcctctcttccagaggaa
agcaaagagcgtgtcagggaaaagatggatgaggtattggagaatctccttaacataggc
catattaggcacaacaagatgaagaatatctctgggggagagcagaaaagggcaaatctt
gcaaggacctttaccaagatgcttttgctggagggagagctaaaggtagtgcttcttgat
gagccaaccagtgagcttgacgccgggctggcactgaagttgggagagttcctccgcgat
tatgccaggaggagtaattccatcgtgctcgtaactgttcaccagccaggggcagagctt
tacaatacctttgataacctcctgttcatgaacaacggggaaaagctatatctagggcct
tcacgtgattttatcaagttcttgggcaccaagggaatccacaacgacggtgggccagag
actaacatggagtttctcttcagccttttcacgaaagggtccaagatgtcgaagaaatac
gagaagcaacttgagcagatagccaaggaaatgaatgaggaaaagaaggaagaaaagaag
ctcagaacctctgacgacacagagattaattttatccccaatctctatgtgtccttccag
atggccataaggcagataattatagactggaggaatcgggaaatcttgtacagtcttgct
atgcccatcgccatggctcttttccttgttaccggtaagtatatatacaaggacttttct
atcgctactattaaggcatctatgctgtctctttctctgtattatgtaatgaatccatct
ggactgatgaacgataaacactatgtcactgaggaatccaatagaaagctatatggtgct
gcagaggtgtggttctcttcattgatctctgatactctcgtatctattttgaagtactgc
attttctttggaattatatatgcttttgggttaattagtatggaccatgcgttccttgga
caagtacttatgtacactttgggaggtactgtatcctccatgttattcaggtctatggcc
agtcctctatcaactcttggaaaagtttttaatacaaccatggtgcttatgtttcaacta
tctggggctttacttggagccggggctttacttggagcccttactttatggatcagtgtt
attcctgaaggatccattcctcaggaggaaattgatgcgtttattagtaacttttttgat
agtacgggtagtacgggtagtaccagtatattctctaaggtgggatcctgggtaattcgt
tttatatgccttgttcccaaggtagttaggtcattcctaaggatcttgttcttgatgttc
catccttttgcttttttccattcatctatcttggatgcagaaaaaagttcatacaagctc
tttttttga

DBGET integrated database retrieval system