KEGG   Escherichia coli APEC O1 (APEC): APECO1_1117Help
Entry
APECO1_1117       CDS       T00425                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
ecv00340  Histidine metabolism
ecv01100  Metabolic pathways
ecv01110  Biosynthesis of secondary metabolites
ecv01230  Biosynthesis of amino acids
Module
ecv_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ecv00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    APECO1_1117 (hisD)
Enzymes [BR:ecv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     APECO1_1117 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh FdhE
Motif
Other DBs
NCBI-ProteinID: ABJ01422
UniProt: A0A0H2Z076
Structure
PDB: 

Position
2179890..2181203
Genome map
AA seq 437 aa AA seqDB search
MIAMSFNTIIDWNSCTAEQQRQLLMRPAISASESITRTVNDILDNVKTRGDEALREYSAK
FDKTTVTALKVSAEEIAAASERLSDELKQAMAVAVKNIETFHTAQKLPPVDVETQPGVRC
QQVTRPVASVGLYIPGGSAPLFSTVLMLATPARIAGCKKVVLCSPPPIADEILYAAQLCG
VRDVFNVGGAQAIAALAFGTESVPKVDKIFGPGNAFVTEAKRQASQRLDGAAIDMPAGPS
EVLVIADSGATPDFVASDLLSQAEHGPDSQVILLTPDADMARRVAEAVERQLAELPRAET
ARQALNASRLIVTKDLAQCVEISNQYGPEHLIIQTRNARELVDGITSAGSVFLGDWSPES
AGDYASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSKEGFSTLASTIETLAAAERLT
AHKNAVTLRVNALKEQA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgccatgagctttaacacaatcattgactggaatagctgtactgcggagcaacaa
cgccagctgttaatgcgcccggcgatctccgcttctgaaagcattacccgcaccgttaac
gatattctcgataacgtgaaaacgcgtggcgatgaagccctgcgtgaatacagcgcgaag
tttgataaaaccacggttaccgcgctgaaggtgtctgctgaggagatcgccgccgccagc
gaacgcctgagcgacgagctaaaacaggcgatggcggtggcagtaaagaatattgaaacc
ttccacactgcgcaaaaactgccgccggtagatgtagaaacgcagccaggcgtgcgttgc
cagcaggtcacgcgcccggtggcttcagtgggtttgtatattcctggcggctccgccccg
ctcttctcaacggtattaatgctggcaactccggcgcgtattgcgggctgtaaaaaagtg
gtgctgtgctcaccgccgccgattgccgatgagatcctttatgcggcgcagctgtgcggt
gtgcgggacgtgtttaacgtcggcggcgcacaggccattgccgcactggcgtttggtaca
gaatccgtgccgaaagtggacaaaatcttcgggccaggtaacgcctttgtcaccgaggca
aaacgtcaggcgagccagcgtctggacggtgcggctatcgatatgcccgcaggcccgtcg
gaagtgttggtcattgctgacagcggcgctacgccggatttcgtggcttctgatttgctt
tctcaggctgaacacggcccggactcacaggtgattttactgacccccgacgccgatatg
gcgcgtcgcgttgccgaggccgtcgaacgccaactggcagaactgccgcgtgccgaaacc
gcccgccaggcactgaacgccagccgcctgatcgtgactaaagatttagcgcagtgcgtg
gagatctccaaccagtacggcccggagcacctgatcattcagacccgcaacgcccgcgaa
ctggtcgatggcatcaccagcgccggttcggtatttctcggtgactggtcaccggaatcg
gcaggtgattacgcctccggcaccaatcacgtgctgccgacttacggttacaccgccacc
tgttccagcctcgggctggcagatttccagaaacgcatgaccgtacaggaactgtcgaaa
gaaggcttttccacgctggcttcgaccattgaaacactggccgccgccgagcgcctgacc
gcccacaaaaatgccgttactttgcgtgttaacgcccttaaggagcaagcatga

DBGET integrated database retrieval system