KEGG   Escherichia coli APEC O1 (APEC): APECO1_1139Help
Entry
APECO1_1139       CDS       T00425                                 

Gene name
cpsB
Definition
(GenBank) Mannose-1-phosphate guanylyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
ecv00051  Fructose and mannose metabolism
ecv00520  Amino sugar and nucleotide sugar metabolism
ecv01100  Metabolic pathways
ecv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    APECO1_1139 (cpsB)
   00520 Amino sugar and nucleotide sugar metabolism
    APECO1_1139 (cpsB)
Enzymes [BR:ecv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     APECO1_1139 (cpsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer Cupin_2 NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABJ01444
UniProt: A0A0H2Z0X3
Position
complement(2210128..2211564)
Genome map
AA seq 478 aa AA seqDB search
MAQSKLYPVVMAGGSGSRLWPLSRVLYPKQFLCLKGDLTMLQTTICRLNGVECESPVVIC
NEQHRFIVAEQLRQLNKLTENIILEPAGRNTAPAIALAALAAKRHSPESDPLMLVLAADH
VIADEDAFRAAVRNAMPYAEAGKLVTFGIVPDLPETGYGYIRRGEVSAGEQDTVAFEVAQ
FVEKPNLETAQAYVASGEYYWNSGMFLFRAGCYLEELKKYRPDILDACEKAMSAVDPDLD
FIRVDEEAFLACPEESVDYAVMERTADAVVVPMDAGWSDVGSWSSLWEISAHTAEGNVCH
GDVINHKTENSYVYAESGLVTTVGVKDLVVVQTKDAVLIADRNAVQDVKKVVEQIKADGR
HEHRVHREVYRPWGKYDSIDAGDRYQVKRITVKPGEGLSVQMHHHRAEHWVVVAGTAKVT
IDGDIKLLGENESIYIPLGATHCLENPGKIPLDLIEVRSGSYLEEDDVVRFADRYGRV
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtcgaaactctatccagttgtgatggcaggtggctccggtagccgcttatgg
ccgctttcccgcgtactttaccccaagcagtttttatgcctgaaaggcgatctcaccatg
ctgcaaaccaccatctgccgcctgaacggcgtggagtgcgaaagcccggtggtgatttgc
aatgagcagcaccgctttattgtcgcggaacagctgcgtcaactgaacaaactcaccgag
aacattattctcgaaccggcagggcgtaacactgcacctgccattgcgctggcggcgctg
gcggcaaaacgtcatagcccggagagcgacccgttaatgctggtcttggcggcggatcat
gtgattgccgatgaagacgcgttccgtgccgccgtgcgtaatgccatgccatatgccgaa
gcgggcaagctggtgaccttcggcattgtgccggatctacctgaaaccggatatggctat
attcgtcgcggtgaagtgtctgcgggtgagcaggatacggtggcctttgaagtggcgcag
tttgtcgaaaaaccgaatctggaaaccgcccaggcctatgtagcaagcggcgaatattac
tggaacagcggcatgttcctgttccgcgccggatgctatctcgaagaactgaaaaaatat
cgcccggatattctcgacgcctgtgaaaaagcgatgagcgccgtcgatccggatctcgat
tttattcgtgtggatgaagaagcgtttctggcctgcccggaagagtcggtggattacgcg
gtcatggaacgaacggcagatgccgttgtggtgccgatggatgcaggctggagcgatgtc
ggctcctggtcctctttatgggagatcagcgcccacaccgccgagggcaacgtttgccac
ggtgatgtgattaatcacaaaaccgaaaacagctatgtgtatgccgaatctggcctggtc
accaccgtcggggtgaaagatttggtggtagtgcagaccaaagatgcggtgctgattgcc
gaccgtaacgcggttcaggatgtgaaaaaagtggtcgagcagatcaaagccgatggtcgc
catgagcatcgggtgcatcgcgaagtgtatcgcccgtggggcaaatatgactctatcgac
gcgggcgatcgctaccaggtgaaacgcatcaccgtgaaaccgggcgaaggtttgtcggta
cagatgcatcatcaccgcgcggaacactgggtagtggtcgcaggaacggcaaaagtcacc
atcgacggtgatatcaagctgcttggtgaaaacgagtccatttatattccgctgggggcg
acgcattgcctggaaaacccggggaaaattccgctcgatttaattgaagtacgctccggc
tcttatctcgaagaggatgatgtggtgcgcttcgcggatcgctacggacgggtgtag

DBGET integrated database retrieval system