KEGG   Escherichia coli APEC O1 (APEC): APECO1_118Help
Entry
APECO1_118        CDS       T00425                                 

Gene name
ycdW
Definition
(GenBank) putative dehydrogenase
  KO
K12972  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
ecv00260  Glycine, serine and threonine metabolism
ecv00620  Pyruvate metabolism
ecv00630  Glyoxylate and dicarboxylate metabolism
ecv01100  Metabolic pathways
ecv01110  Biosynthesis of secondary metabolites
ecv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    APECO1_118 (ycdW)
   00630 Glyoxylate and dicarboxylate metabolism
    APECO1_118 (ycdW)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    APECO1_118 (ycdW)
Enzymes [BR:ecv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     APECO1_118 (ycdW)
    1.1.1.81  hydroxypyruvate reductase
     APECO1_118 (ycdW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C NAD_binding_2 DUF551
Motif
Other DBs
NCBI-ProteinID: ABJ00421
UniProt: A1A9T1
Position
1080202..1081179
Genome map
AA seq 325 aa AA seqDB search
MRINFAQRFSGVSMDIIFYHPTFDTQWWIEALRKAIPQARVRAWKSGDNDSADYALVWHP
PVEMLAGRDLKAVFALGAGVDSILSKLQAHPEMLKPSVPLFRLEDTGMGEQMQEYAVSQV
LHWFRRFDDYRIQQNSSHWQPLPEYHREDFTIGILGAGVLGSKVAQSLQTWRFPLRCWSR
TRKSWPGVQSFAGREELSAFLSQCRVLINLLPNTPETVGIINQQLLEKLPDGAYLLNLAR
GVHVVEDDLLAALDSGKVKGAMLDVFNREPLPPESPLWQHPRVTITPHVAAITRPAEAVE
YISRTIAQLEKGERLCGQVDRARGY
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaataaattttgcgcaacgcttttcgggagtcagtatggatatcatcttttatcac
ccaacgttcgatacccaatggtggattgaggcactgcgcaaagctattcctcaggcaaga
gtcagagcatggaaaagcggagataatgactctgctgattatgctttagtctggcatcct
ccagttgaaatgctggcagggcgcgatcttaaagcggtgttcgcactcggggccggtgtt
gattctattttgagcaagctacaggcacaccctgaaatgctgaagccttctgttccactt
tttcgcctggaagataccggtatgggcgagcaaatgcaggaatatgctgtcagtcaggtg
ctgcattggtttcgacgttttgacgattaccgcatccagcaaaatagttcgcattggcaa
ccgcttcctgaatatcatcgggaagattttaccatcggcattttgggcgcaggcgtactg
ggcagtaaagttgcacagagtctgcaaacctggcgcttcccgctgcgttgctggagtcga
acccgtaaatcgtggcctggcgtgcaaagctttgccggacgagaagaactgtctgcattt
ctgagccaatgccgggtattgattaatctgttaccgaatacacctgaaaccgtcggcatt
attaatcaacaattactcgaaaaattaccggatggcgcgtatctcctcaacctggcgcgt
ggtgttcatgtcgtggaagatgacctgctcgcggcgctggatagcgggaaagttaaaggc
gcaatgttggatgtttttaatcgtgaacccttaccgccggaaagtccgctctggcaacat
ccacgcgtgacgataacaccacatgtcgccgcgattacccgtccagctgaagctgtggag
tacatttctcgcaccattgcccagctcgaaaaaggggagaggctctgcgggcaagtcgac
cgcgcacgcggctactaa

DBGET integrated database retrieval system