KEGG   Escherichia coli APEC O1 (APEC): APECO1_1543Help
Entry
APECO1_1543       CDS       T00425                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
ecv03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ecv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    APECO1_1543 (recR)
DNA repair and recombination proteins [BR:ecv03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     APECO1_1543 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      APECO1_1543 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim FYVE_2 HHH HHH_5 Toprim_2
Motif
Other DBs
NCBI-ProteinID: ABI99927
UniProt: A1A8D8
Position
510134..510739
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQYDVEASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKIRF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagcccgctgttaacacagcttatggaagcactgcgctgtctgccgggcgtt
ggcccgaagtcggcgcagcgtatggcgttcacgctgcttcagcgcgatcgtagcggcggg
atgcgtctggcgcaggcgctcacccgggcgatgtcggaaatcggtcactgcgccgattgc
cgcaccttcaccgaacaggaagtctgtaacatctgttcgaatccacgtcgtcaggaaaac
ggtcaaatctgcgtggtggagagtccggcggacatttacgccattgagcagacggggcag
ttttcaggtcgttattttgtgttgatgggacacctgtcaccgctggacggcatcggtcct
gatgatatcgggcttgatcgtctggaacagcgtctggcagaggaaaaaatcactgaagtg
atcctcgccaccaaccccacggttgaaggtgaagctaccgctaactacattgccgagctt
tgtgcgcaatatgacgtggaagccagccgaatcgctcatggcgtaccggttggcggcgaa
ctggaaatggtcgatggcaccacgctgtcacactcccttgccgggcgtcataagattcgt
ttttaa

DBGET integrated database retrieval system