KEGG   Escherichia coli APEC O1 (APEC): APECO1_1758
Entry
APECO1_1758       CDS       T00425                                 

Gene name
aec17
Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
ecv  Escherichia coli APEC O1 (APEC)
Brite
KEGG Orthology (KO) [BR:ecv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecv02044]
    APECO1_1758 (aec17)
Secretion system [BR:ecv02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   APECO1_1758 (aec17)
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABI99712
UniProt: A0A0H2YVT9
Position
complement(262509..263012)
AA seq 167 aa
MSKMNNNGGSVAPKERISVRYTPKVDGVAADIELPLNLLITGNLKGKPDNTPLDERTAIA
INRYNLNAVISEADIEREFVVPAELSDAPNEQMYVNLKVKSMDDLSPDHIASQVPEIKRL
LELREALVALKSPLGNIPAFRAQLQALLENEDTREQLIQELGIAVQK
NT seq 504 nt   +upstreamnt  +downstreamnt
atgagcaaaatgaacaacaatggcggcagtgtcgcgccgaaagaaagaatcagcgttcgg
tatacaccaaaagttgatggggtggctgctgatatcgaattgccgctgaatttattgatc
accggcaatctgaaagggaaaccagataacacgccgttggatgagcgaactgccattgct
atcaaccgctataacctcaacgcagtcatttcagaagctgacattgaacgggagtttgtt
gttccggctgaactcagtgacgctcccaatgagcaaatgtacgtcaacctgaaagtcaaa
tctatggatgacctttctcctgaccatattgccagccaggtaccagaaataaaacgtctg
ctcgaattgcgtgaagccctagtcgcacttaagtctccactaggcaatattccagccttc
cgcgcacaacttcaggcgctactggaaaacgaagacacccgcgagcagctgatccaggaa
ctgggtatcgccgttcagaaataa

DBGET integrated database retrieval system