KEGG   Escherichia coli APEC O1 (APEC): APECO1_1766Help
Entry
APECO1_1766       CDS       T00425                                 

Gene name
aec26
Definition
(GenBank) conserved hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
ecv03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ecv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    APECO1_1766 (aec26)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecv02044]
    APECO1_1766 (aec26)
Secretion system [BR:ecv02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   APECO1_1766 (aec26)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU DUF2721
Motif
Other DBs
NCBI-ProteinID: ABI99704
UniProt: A0A0H2YVW0
Position
complement(253776..254540)
Genome map
AA seq 254 aa AA seqDB search
MSDMSEASVFPVEPESGTPGRQYRLALRGNSLNPMIDAATPLLGMVMRLSTMNSQAMPEH
LFTQVVTDVQAVEQLLQEQGYEPGVIVSFRYILCTFIDEAALGNGWSNKNEWIKQSLLVH
FHNEAWGGEKVFILLERLIREPVRYQDLLEFLYLCFSLGFRGRYKVAIQQQDEFERIYQR
LHHALHKLRGDAPFPLLHQKNNIQGGRYQLIRRLTIKHVLCGGLVVLTVFYLFYLLRLDS
QTQDILHQLNKLLR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatatgagtgaagcgtcggtttttcccgtggagccggagagcggaacaccagga
cgccagtaccgtctcgcccttcgcggcaacagcctgaatccaatgattgacgccgccacg
ccgttgctcggcatggtgatgcgtctgtccactatgaacagtcaggccatgccggaacat
ctgtttacccaggtagtaaccgatgtccaggccgtagagcaactactccaggaacaggga
tacgaaccgggcgtcattgtttcgttccgttacattctctgcacgtttattgatgaagcg
gcgctgggcaacggctggtccaacaaaaacgaatggatcaaacagtcgctgctggttcat
tttcataacgaagcctggggcggcgagaaagtgtttatcctgctcgaacgcctgatccgg
gagccggtacgttaccaggatctgctggaatttttatacctctgtttttcgctcggcttt
cgcgggcgctacaaggttgccattcagcaacaggatgaatttgagcggatctaccagcgc
ctgcaccatgccctgcacaaactgcgcggtgacgcgccatttccgctacttcatcagaag
aacaacatacagggtgggcgttatcagttaatccgacgactgaccatcaagcatgtactg
tgcggcggtcttgttgtgctgaccgtattttatctgttttatctgctgcgtctggacagc
cagacacaggatattctgcatcagctcaataaattactccgataa

DBGET integrated database retrieval system