KEGG   Escherichia coli APEC O1 (APEC): APECO1_2366Help
Entry
APECO1_2366       CDS       T00425                                 

Gene name
yjcT
Definition
(GenBank) D-allose kinase
  KO
K00881  allose kinase [EC:2.7.1.55]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
ecv00051  Fructose and mannose metabolism
ecv01100  Metabolic pathways
ecv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    APECO1_2366 (yjcT)
Enzymes [BR:ecv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.55  allose kinase
     APECO1_2366 (yjcT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ABJ03571
UniProt: A0A0H2Z4S8
Structure
PDB: 

Position
complement(4653536..4654465)
Genome map
AA seq 309 aa AA seqDB search
MQKQHNVVAGVDMGATHIRFCLRTAEGETLHCEKKRTAEVIAPDLVSGIGEMIDEQLRRF
NARCHGLVMGFPALVSKDKRTIISTPNLPLTAADLYDLADKLENTLNCPVEFSRDVNLQL
SWDVVENRLTQQLVLAAYLGTGMGFAVWMNGAPWTGAHGVAGELGHIPLGDMTQHCACGN
PGCLETNCSGMALRRWYEQQPRNYPLSDLFVHAENAPFVQSLLENAARAIATSINLFDPD
AVILGGGVMDMPAFPPETLIAMTQKYLRRPLPYQVVRFIAASSSDFNGAQGAAILAHQRF
LPQSCAKVP
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaacagcataacgtcgtagcgggcgtggatatgggggcaacgcatatccgcttt
tgtctgcggacagcagaaggtgaaacgctacactgcgaaaaaaagcggaccgcagaagtt
attgctcccgacctggtgtcgggtatcggcgaaatgattgacgagcaactcaggcgcttt
aacgctcgctgtcatggtctggtgatgggatttccggcgctggtcagtaaagataaacgc
accattatttctacgcctaacctgccgttaacagcggcagatttatatgatctcgccgat
aagctcgaaaatacgctgaattgtccggttgagttttcccgcgacgttaacctgcaactc
tcctgggacgtagtagaaaatcgccttacgcaacaactggttctggcagcctatctcggt
acggggatggggttcgcagtgtggatgaacggtgcgccgtggacgggtgcacacggtgtg
gcaggcgaactgggccatatccccctgggagatatgacccaacactgcgcgtgtggtaat
cctgggtgcctggaaaccaattgctctggaatggcgctaagacgctggtacgaacaacag
ccccgaaattacccattgagcgatcttttcgtccatgcggaaaacgcccctttcgtccag
agtctgcttgaaaacgcggcacgagccattgccaccagcattaatctgttcgatcccgat
gcggtgattctgggtggtggcgtgatggatatgcccgccttcccacccgagactctcatt
gccatgacccaaaagtacctgcgccgtccactgccgtatcaggttgtgcgctttattgcc
gcctcatcttctgactttaatggcgctcagggtgcagcaatattggcgcatcaacgtttt
ttgccacagtcctgtgctaaagtcccatga

DBGET integrated database retrieval system