KEGG   Escherichia coli APEC O1 (APEC): APECO1_2409Help
Entry
APECO1_2409       CDS       T00425                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
ecv00020  Citrate cycle (TCA cycle)
ecv00310  Lysine degradation
ecv01100  Metabolic pathways
ecv01110  Biosynthesis of secondary metabolites
ecv01120  Microbial metabolism in diverse environments
ecv01130  Biosynthesis of antibiotics
ecv01200  Carbon metabolism
Module
ecv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ecv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    APECO1_2409
  Amino acid metabolism
   00310 Lysine degradation
    APECO1_2409
Enzymes [BR:ecv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     APECO1_2409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H DUF4331
Motif
Other DBs
NCBI-ProteinID: ABJ03527
UniProt: A0A0H2Z5J9
Position
4599596..4600750
Genome map
AA seq 384 aa AA seqDB search
MIEITVPVLPESVTEGTLTTWCKQEGEHVKRDDVIAELETDKVILEIPAPHDGVLSNIIV
SEGSTVTSAQLLAHLKPQAVIEETVTPVTETLAMPSARLEAQRSGVELADVAGSGRNGRI
LKEDVQRVTPAPVIQPERVAEIAPAKPLTPGARQERREPMSRLRQRIAERLLASQQNNAI
LTTFNEVNMQSVMDLRTRWKDRFAEKHGVKLGFMSFFVKAVTRALERFPVVNASVDGNEI
IWRDYCDIGIAVSSNRGLVVPVLRNAQSLSLVEIERQIAEYATQARNGKLPLEALQGGTF
SITNGGTFGSMMSTPIINPPQSAILGMHAITPRPVAENGQVVIRPMMYLALSYDHRIIDG
QEAVQTLVAIRELLESPEQLLLDL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattactgtccctgtattaccggaatctgtcacggaaggcacgctgacaacc
tggtgtaaacaagaaggcgagcacgtaaaacgcgatgatgtgattgccgagctggaaacc
gataaagtcattctggaaataccggccccgcacgatggcgtgttaagcaatattatcgtc
agcgaaggtagcacggtcacgtccgcgcaactgttggcgcatcttaagccgcaagctgtc
atagaagaaaccgtcacaccagtcaccgaaaccctggcgatgccttccgcacggctggag
gcacagcgtagtggtgttgaacttgctgacgttgcggggagcgggagaaatggacgtatc
ctgaaagaggatgtacagcgcgttactcctgcaccagtcattcagcctgaacgggtggcg
gagatcgcgccagctaaacccttgacaccgggtgctcgtcaggaacgtcgtgagccgatg
tcgcgcttacgtcagcgaattgctgagcgtctgctggcttcccaacaaaataacgccatt
cttaccacattcaacgaagtaaacatgcagagcgtgatggatttacgcacccgctggaaa
gatcgttttgccgagaagcacggcgtgaagctgggctttatgtccttctttgttaaggcc
gttacccgggcgctggagcgcttccctgtagtgaatgccagcgttgatggcaacgagatt
atctggcgtgattattgcgatatcggcattgcagtgagcagcaaccgcggcctggtagtg
cctgtgttacgcaatgcgcaatcactctctttggtggaaattgaacggcaaattgccgaa
tacgccacacaggcacgcaatggcaaattgccgctggaggcgttacagggcggcacgttc
tctatcaccaacggcggtacttttggttcgatgatgtcaacgccaatcattaacccgccg
cagtcggccattcttgggatgcatgccatcacgccgcgcccggtcgcagaaaacggccag
gttgttattcgtcccatgatgtaccttgctctcagctatgaccatcgcattatcgatggt
caggaagccgtgcagacattggtggcaatacgtgagctactggaatcaccggaacaactg
ttgctggatctttaa

DBGET integrated database retrieval system