KEGG   Escherichia coli APEC O1 (APEC): APECO1_2449Help
Entry
APECO1_2449       CDS       T00425                                 

Definition
(GenBank) putative sorbose PTS component
  KO
K02812  PTS system, sorbose-specific IIA component [EC:2.7.1.206]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
ecv00051  Fructose and mannose metabolism
ecv01100  Metabolic pathways
ecv02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:ecv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    APECO1_2449
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    APECO1_2449
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecv02000]
    APECO1_2449
Enzymes [BR:ecv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     APECO1_2449
Transporters [BR:ecv02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    APECO1_2449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EIIA-man STb_secrete HTH_DeoR
Motif
Other DBs
NCBI-ProteinID: ABJ03487
UniProt: A0A0H2Z538
Position
complement(4552746..4553153)
Genome map
AA seq 135 aa AA seqDB search
MVNAIFCAHGKLACAMLESVQMVYGDARVEAVEFVPGENAGDIVAKLEKLVSIHNHDEWL
IAVDLQCGSPWNAAAMLAMRNPRLRVISGLSLPLALELVDNQDSMNVDELCEHLTQIAKQ
TCVVWRQVATAEEDF
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggtcaatgccattttttgcgcccacggcaaattagcctgcgccatgctggaatcggtt
cagatggtgtacggcgatgccagggtcgaggcagttgaatttgtgcccggcgagaacgcc
ggagacattgtggcaaagctggagaagttagtgagcattcacaatcatgacgagtggcta
atcgccgtggatttacagtgcggcagcccgtggaatgcggcagcgatgcttgcgatgcgc
aatcctcgtctgcgggtaatcagcggcctttctctgccgctggcgctcgaactggttgat
aaccaggacagcatgaatgttgatgaactgtgtgaacacctgacgcaaatcgcaaagcaa
acctgcgtcgtctggagacaggtagcaacagcagaggaggatttctga

DBGET integrated database retrieval system