KEGG   Escherichia coli APEC O1 (APEC): APECO1_2611Help
Entry
APECO1_2611       CDS       T00425                                 

Gene name
fadB
Definition
(GenBank) multifunctional protein; 3-hydroxyacyl-CoA dehydrogenase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
ecv00071  Fatty acid degradation
ecv00280  Valine, leucine and isoleucine degradation
ecv00281  Geraniol degradation
ecv00310  Lysine degradation
ecv00362  Benzoate degradation
ecv00380  Tryptophan metabolism
ecv00410  beta-Alanine metabolism
ecv00640  Propanoate metabolism
ecv00650  Butanoate metabolism
ecv00903  Limonene and pinene degradation
ecv00930  Caprolactam degradation
ecv01040  Biosynthesis of unsaturated fatty acids
ecv01100  Metabolic pathways
ecv01110  Biosynthesis of secondary metabolites
ecv01120  Microbial metabolism in diverse environments
ecv01130  Biosynthesis of antibiotics
ecv01200  Carbon metabolism
ecv01212  Fatty acid metabolism
Module
ecv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ecv00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    APECO1_2611 (fadB)
   00650 Butanoate metabolism
    APECO1_2611 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    APECO1_2611 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    APECO1_2611 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    APECO1_2611 (fadB)
   00310 Lysine degradation
    APECO1_2611 (fadB)
   00380 Tryptophan metabolism
    APECO1_2611 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    APECO1_2611 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    APECO1_2611 (fadB)
   00281 Geraniol degradation
    APECO1_2611 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    APECO1_2611 (fadB)
   00930 Caprolactam degradation
    APECO1_2611 (fadB)
Enzymes [BR:ecv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     APECO1_2611 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     APECO1_2611 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     APECO1_2611 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     APECO1_2611 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ABJ03323
UniProt: A0A0H2Z529
Position
complement(4347126..4349441)
Genome map
AA seq 771 aa AA seqDB search
MISAERDQIGISLIFYLHIFNTKYTLRCIWYDQITLRIQETDMLYKGDTLYLDWLEDGIA
ELVFDTPGSVNKLDTATVASLGEAIGVLEQQSDLKGLLLRSNKAAFIVGADITEFLSLFL
VPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLP
ETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVEGAI
AILRQAINGDLDWKAKRQPKLEPLKLSKIEAAMSFTIAKGMVAQTAGKHYPAPITAVKTI
EAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVKGKAKKLTKDVETPKQAAV
LGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLLNKQLERGKIDGLKLAGVI
STIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQKVRPDTVLASNTSTIPISELAN
ALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAWASKMGKTPIVVNDCPGFF
VNRVLFPYFAGFSQLLRDGAGFRKIDKVMEKQFGWPMGPAYLLDVVGIDTAHHAQAVMAA
GFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSKGKPKKEEDVVVDDLLAKVSQP
KRDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADMALVYGLGFPPFHGGAFRWLDTL
GSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPPVEPARPVGDLKTA
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
gtgatttctgccgagcgtgatcagatcggcatttccttaatattttatttgcatattttt
aacacaaaatacacacttcgatgcatctggtacgaccagatcaccttgcggattcaggag
actgacatgctttacaaaggcgacaccctttaccttgactggctggaagatggcattgcc
gaactggtatttgataccccaggttcagttaataaactcgacactgcgaccgtcgccagc
ctcggcgaggccatcggcgtgctggaacagcaatcagatctaaaaggactgctgctacgt
tcgaacaaagcagcctttatcgtcggtgctgatatcaccgaatttttgtccctgttcctc
gttcctgaagaacagttaagtcagtggctgcactttgccaatagcgtgtttaatcgcctg
gaagatctgccggtgccgaccattgctgccgtcaacggctatgcgctgggcggtggctgc
gaatgcgtgctggcgaccgattatcgtctggcgacgccggatctgcgcatcggtctgccg
gaaaccaaattgggcatcatgccgggctttggcggttctgtacgtatgccacgtatgctg
ggcgctgacagtgcgctggaaatcattgccgccggtaaagatgtcggcgcggatcaggcg
ctgaaaatcggtctggtggatggcgtagtcaaagcagaaaaactggttgaaggggcgata
gcgattttacgccaggccattaacggcgacctcgactggaaagcaaaacgtcagccgaag
ctggaaccgctaaaactgagcaagattgaagccgccatgagcttcaccatcgctaaaggg
atggtcgcgcaaacggcggggaaacattatccggcccccatcaccgcagtaaaaaccatt
gaagctgcggcccgttttggtcgtgaagaagccttaaacctggaaaacaaaagttttgtc
ccgctggcgcataccaacgaagcccgcgcactggtcggcattttccttaacgatcaatat
gtaaaaggtaaagcgaagaaactcaccaaagatgttgaaaccccgaaacaggccgctgtg
ctgggcgcaggcattatgggcggcggcatcgcctaccagtctgcgtggaaaggcgtgccg
gttgtcatgaaagatatcaacgacaagtcgttaaccctcggcatgaccgaagccgcgaaa
ctgctgaacaagcagcttgagcgcggcaagatcgatggtctgaaactggctggcgtgatc
tccacaattcacccaacgctcgactacgccgggtttgaccgcgtggatgttgtggtagaa
gcggttgttgaaaacccgaaagtgaaaaaagccgtgctggcagaaaccgagcagaaagta
cgcccggataccgtgctggcgtctaacacttcaaccattcctatcagcgaactggccaac
gcgctggaacgtccggaaaacttctgcgggatgcacttctttaacccggtgcaccggatg
ccgttggtggaaattattcgcggcgagaaaagctccgacgaaaccatcgcgaaagtcgtc
gcctgggcgagcaagatgggcaagacgccgattgtggtcaacgactgccccggcttcttc
gtcaaccgtgtgctgttcccctatttcgccggtttcagccagttgctgcgcgacggcgcg
ggtttccgcaagatcgacaaagtgatggaaaaacagtttggctggccgatgggtccggca
tatctgctggatgttgtgggcattgacaccgcgcatcacgctcaggctgtcatggcagca
ggcttcccgcagcggatgcagaaagattatcgcgatgccatcgacgcgctgtttgatgcc
aaccgctttggtcagaagaacggcctcggtttctggcgttataaagaagacagcaaaggt
aagccgaagaaagaagaagatgtcgtcgttgacgacctgctggcaaaagtgagccagccg
aagcgcgatttcagcgaggaagagattatcgcccgcatgatgatcccgatggtcaacgaa
gtggtccgctgtctggaagagggcattatcgccactccggcagaagcggatatggcgctg
gtctacggcctgggcttccctccgttccacggcggcgcgttccgctggctggacaccctc
ggcagcgcaaaatacctcgatatggcacagcaatatcagcacctcggcccgctgtatgaa
gtaccggaaggtctgcgtaataaagcacgtcataacgaaccgtactatcccccggttgag
ccagcccgtccggttggcgacctgaaaacggcttaa

DBGET integrated database retrieval system