KEGG   Escherichia coli APEC O1 (APEC): APECO1_3218Help
Entry
APECO1_3218       CDS       T00425                                 

Gene name
nanA
Definition
(GenBank) N-acetylneuraminate lyase
  KO
K01639  N-acetylneuraminate lyase [EC:4.1.3.3]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
ecv00520  Amino sugar and nucleotide sugar metabolism
ecv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    APECO1_3218 (nanA)
Enzymes [BR:ecv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.3  N-acetylneuraminate lyase
     APECO1_3218 (nanA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS
Motif
Other DBs
NCBI-ProteinID: ABJ02709
UniProt: A1AGB9
Structure
PDB: 

Position
complement(3656943..3657836)
Genome map
AA seq 297 aa AA seqDB search
MATNLRGVMAALLTPFDQQQALDKASLRRLVQFNIQQGIDGLYVGGSTGEAFVQSLSERE
QVLEIVAEEAKGKIKLIAHVGCVSTAESQQLAASAKRYGFDAVSAVTPFYYPFSFEEHCD
HYRAIIDSADGLPMVVYNIPALSGVKLTLDQINTLVTLPGVGALKQTSGDLYQMEQIRRE
HPDLVLYNGYDEIFASGLLAGADGGIGSTYNIMGWRYQGIVKALKEGDIQTAQKLQTECN
KVIDLLIKTGVFRGLKTVLHYMDVVSVPLCRKPFGPVDEKYLPELKALAQQLMQERG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgaatttacgtggcgtaatggctgcactcctgactccttttgaccaacaacaa
gcactggataaagcgagtctgcgccgcctggttcagttcaatattcagcagggcatcgac
ggtttgtacgtgggtggttcgacaggcgaagcctttgtacagagcctttcagagcgtgaa
caggtactggaaatcgtcgctgaagaggcgaaaggtaagattaaactcatcgcccacgtc
ggttgcgtcagcaccgccgaaagccaacaacttgcggcatcggctaaacgttatggcttc
gatgccgtctccgccgtcacgccgttctactatcctttcagctttgaagaacactgcgat
cactatcgggcaattattgattcggcggatgggttgccgatggtggtgtacaacattcca
gccctgagcggggtaaaactgaccctggatcagattaacactctggttacgctgcctggt
gtaggtgcgctgaaacagacctctggcgatctctatcagatggagcagatccgtcgtgaa
catcctgatctggtgctctataacggttacgacgaaatcttcgcctctggtcttctggcg
ggcgcagacggcggtatcggcagcacttacaacatcatgggctggcgttatcaggggatc
gtgaaggcgctgaaagaaggcgatatccagaccgcgcagaaactgcaaactgagtgcaac
aaagtcattgatttactgatcaaaacgggcgtattccgcggcctgaaaactgtcctgcat
tatatggatgtcgtttctgtgccgctgtgccgcaaaccgtttggtccggtagatgaaaaa
tatctgccagaactgaaggcgctggcccagcagttgatgcaagagcgcgggtga

DBGET integrated database retrieval system