KEGG   Escherichia coli APEC O1 (APEC): APECO1_3718
Entry
APECO1_3718       CDS       T00425                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
ecv  Escherichia coli APEC O1 (APEC)
Brite
KEGG Orthology (KO) [BR:ecv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecv02044]
    APECO1_3718
Secretion system [BR:ecv02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   APECO1_3718
SSDB
Motif
Pfam: T6SS_VipA GerD Imm65
Other DBs
NCBI-ProteinID: ABJ02240
UniProt: A0A0H2Z254
Position
3117169..3117669
AA seq 166 aa
MADSFQNEVPTARVNIKLDLHTGNAKKKVELPLKLLAVGDYSNGKEQRPLSERDKVDINK
NNFNSVMAEFSPAVNLTVEDTLNGNGNEQNIALEFKSLKDFEPEQVAKNIPQLRVLLAMR
NLLRDLKSNLLDNATFRRELENILKDPTLSSELRDELAKIAPQENV
NT seq 501 nt   +upstreamnt  +downstreamnt
atggctgacagtttccagaatgaagttcccaccgctcgtgtaaatatcaagcttgatctg
catacaggcaatgctaaaaagaaagttgaactccccctcaagcttcttgccgtaggcgat
tacagtaacggaaaagagcaacgtccgctgtccgaacgggacaaggttgatatcaataaa
aacaacttcaacagcgtcatggctgagttttcgcctgcggttaatttaacagtagaagat
acgctaaacggaaacggtaatgaacaaaatatcgcgcttgaatttaaaagcctgaaggat
tttgaacccgaacaggtagcaaaaaatattccgcaacttcgtgtattactcgctatgcgc
aatttactacgtgacctgaaatccaatctgctggataacgcaacgtttcgccgtgaactg
gaaaatattctgaaagacccgacgctcagttcagaactgcgtgatgaactggcgaaaatt
gcgccgcaggagaacgtttaa

DBGET integrated database retrieval system