KEGG   Escherichia coli APEC O1 (APEC): APECO1_O1CoBM46
Entry
APECO1_O1CoBM46   CDS       T00425                                 
Symbol
traF
Name
(GenBank) TraF
  KO
K12057  conjugal transfer pilus assembly protein TraF
Organism
ecv  Escherichia coli APEC O1 (APEC)
Brite
KEGG Orthology (KO) [BR:ecv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecv02044]
    APECO1_O1CoBM46 (traF)
Secretion system [BR:ecv02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   APECO1_O1CoBM46 (traF)
SSDB
Motif
Pfam: TraF
Other DBs
NCBI-ProteinID: ABD51616
UniProt: A0A0H2XKV5
Position
pAPEC-O1-ColBM:33045..33818
AA seq 257 aa
MKEKVMKGMKMNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAAPRQEPD
IMQKLAALQTATKRALYEAILYPGVDNFVKYFRLQNYWAQQAGLFTMSARKAMLAHPELD
YNLQYSHYNGTVRNQLAADQAQQRQAIAKLAEHYGIMFFYRGQDPIDGQLAQVINGFRDT
YGLSVIPVSVDGVINPLLPDSRTDQGQAQRLGVKYFPAMMLVDPKQGSVRPLSYGFISQD
DLAKQFLNVSEDFKPNF
NT seq 774 nt   +upstreamnt  +downstreamnt
atgaaagaaaaagtgatgaaaggaatgaagatgaataaagcattactgccactgttactc
tgctgctttatttttccggcgtcaggaaaagatgcaggctggcagtggtataacgagaaa
ataaatccgaaggaaaaagaaaataaacctgtacctgcagccccccgtcaggaaccggat
attatgcagaaactggccgcactgcagacggcaacaaagcgggcgctgtacgaagccatt
ctgtatcccggcgtggataattttgtgaaatatttccggctgcaaaattactgggctcag
caggccgggcttttcaccatgagcgccagaaaggccatgctggcacatcctgaactggac
tataacctgcagtacagtcattacaacggcacggtacggaaccagctggcagcagaccag
gcgcagcagcgacaggccattgcgaaactggctgaacactacggcatcatgtttttttac
cgggggcaggaccccatcgacgggcaactggcgcaggtcattaatggcttccgggatacg
tatggtctgagtgttattcccgtttccgtggatggcgtgattaatccgctgttgccggat
tcccggactgaccaagggcaggcgcagcgcctcggcgtgaaatatttcccggccatgatg
ctggttgacccgaaacagggcagtgttcgcccgttatcatacggctttatttcgcaggac
gacctggcaaaacagttcctgaacgtttctgaagattttaaacccaatttttaa

DBGET integrated database retrieval system