KEGG   Escherichia coli APEC O1 (APEC): APECO1_O1R10
Entry
APECO1_O1R10      CDS       T00425                                 
Symbol
trhV
Name
(GenBank) TrhV
Organism
ecv  Escherichia coli APEC O1 (APEC)
SSDB
Motif
Pfam: TraV
Other DBs
NCBI-ProteinID: ABF67693
UniProt: A0A0H2XK26
Position
pAPEC-O1-R:7996..8946
AA seq 316 aa
MNIKRLVLSALVVGTSSYLTGCSIGSSESECPGIEKGVICKGPREVMELTNNRDDLSALA
GEESESGKEKSAVNDSRYPTEISPPGEVKYPQSTTLKNQPVAYSKTEIKPVGQLPVMYDK
TLKMGAPTSSIGPRPISGVPVNSNVRMTSSYSTASSAGNPFVHPAAEVVKQTSYPVSAGN
APRYVAPNSDISPGKDMYSLYNGQPVNPTLNTGQIQQYRSQGYKQAVVAPEPLAVLQQGK
VMRITFAPYTDDNDALNLPGYVYVNVKPQTWIAGKNSTSNPARIVPLEVQDAARENMQQQ
QKATKAVSSNGIVRQL
NT seq 951 nt   +upstreamnt  +downstreamnt
atgaacatcaaaagattggtactcagtgctctggttgtaggtacatcctcatatcttacg
gggtgctccatcgggagttccgaatccgaatgtccaggcattgaaaagggcgttatctgt
aaaggtcctcgcgaagttatggagttaactaataatcgagatgatctgtctgcacttgcg
ggggaagagtcggaatcgggaaaggagaaatcggctgtcaatgacagccgttatccaact
gaaattagccctccaggggaagtcaaatatccacagtctacaacccttaaaaatcagcct
gtggcttattcaaaaaccgaaattaagccagttggtcagttacctgtcatgtacgataaa
actttaaaaatgggtgcccctacttcatccattggaccacggcctatttctggtgtaccg
gttaattcaaacgtaaggatgactagcagttatagcactgcctcttcagctggtaaccct
ttcgttcatccggctgcggaagtcgttaaacaaacaagctatccggtttctgctggaaat
gcaccacgctacgttgcacctaattctgatatcagccctggcaaggatatgtactctctt
tacaatggccagcccgttaaccctactctcaacactgggcagatccagcaataccgttcg
caaggttataaacaagctgtagtggctcctgaaccacttgctgttctgcaacaggggaaa
gtaatgagaattacttttgcaccttataccgatgataacgatgcgcttaatcttcccggc
tacgtttatgtcaacgtaaaaccgcaaacatggattgctggcaagaattcgacctcaaac
ccagctcgcatagttcctttagaagtacaggatgcggcccgggaaaatatgcagcagcaa
caaaaagcaactaaagctgtctcttcgaacggcattgttagacaactgtaa

DBGET integrated database retrieval system