KEGG   Escherichia coli APEC O1 (APEC): APECO1_O1R145
Entry
APECO1_O1R145     CDS       T00425                                 
Symbol
trhG
Name
(GenBank) inner membrane protein
  KO
K12056  conjugal transfer mating pair stabilization protein TraG
Organism
ecv  Escherichia coli APEC O1 (APEC)
Brite
KEGG Orthology (KO) [BR:ecv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecv02044]
    APECO1_O1R145 (trhG)
Secretion system [BR:ecv02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   APECO1_O1R145 (trhG)
SSDB
Motif
Pfam: TraG_N Suv3_N FAD-SLDH
Other DBs
NCBI-ProteinID: ABF67830
UniProt: A0A0H2XKG9
Position
pAPEC-O1-R:complement(162299..166252)
AA seq 1317 aa
MDYNIYTLGDIDFVWSAFTGIALIFSQYTGVKEFLTTAAVVAGVSLFYKTWLWLQAPTKN
ELPFFSWFLGLILFMMAMVRVDVTIESVKSGEVRNVDGIPIFIAAMATVTTNLSQGLLKD
YKTAFDPLSPVDLSATTLDDDITLGPMIRFVKFLQWGGDSQGYCSAFPEPASGLGPMNVC
ATVQSLAYNCLKATQNSSANIAGKETIFNDIFSANLADSMDRINQAMKGALKNASASIVG
ANGSKSGTCDEVWSTVKQVTSTAEARQTISLIGQTNGILTPDEANGAPTGASFTDVMASA
NGMYGKAIGSYDATLNLFIMNELRNGASKYKTPLGLASDMQLFEASLKRTNTMASQGQLW
LQLSGAAIAFLEMFAYMVAPFALLMLLALGGNGVAAAAKYLQLILFVNMWPLTAVMVNAY
VKKVATADLDTWSTLNSQNNAVTWMGLPGLAETYSSYLSVASALYALIPVLTLFLMTQSI
HPMMNAVKGVTPDAPVDTGHVTPKVWDGPNSGKSSFGDVTRTALTSTGQGYSDGGAVDSS
NFRLGMWNAGSSIANSQGQGSAVTSSVMSAASNSFQAGYSQMSEIGRSGQSSQQFSTNLQ
TMKQISDKIGASVAEGIATKHGVSASQMASIASNVILNAGLNGGAGTGNGAGLKAAVAGQ
LSSGASKTNTGSDSLSNDLSKAITNQLSQDSALTDQFSKAASQVSSDQISNTNAFKEASS
KMNQATQTMAQNISTSVSTNASSNSGMSLDSKQSINLDRFSDSIRNKNFSDDDVRNFARK
NGLDENAFMEKFNSYNDTFKASNQLGSQLQRTDALVAATRDFSEQKIAIDTARGETAESN
KQDLRETSSLLKSLVSDFGGNAQQLLPITNQLDRISGDGSGINTITQAQDRTPDSVNTSG
VMSASRVGELGGSVDSQAKLGLSSNAQDATQRVPGKSEAGFTPYNLDNAGKGDIQGIHNN
NVGRTYSDEERNVLNSLKTNGPVLNNQGVEKVVNSGQDVRNAEGTFNDLEKATGGRVVGD
GMDQRATALNSMYQSGQVRGLSNNTDNYFSRVANNPNLSRDDKRAELAQQAVFTYGASTM
ATGAEREQLKADTQKILNELGNYNVNWSMNDVQSIHSSFNTHNRADGSLESVVRANLGEG
GSGGGLVGNRTQTVTDRLVGEKIEANTERGAISGALLGGQQFVSDTLTSVGAKPVNEMLT
GAGILQTQTSIANDASNPANMPDSLQGKVLNHMQMSDGVAAVSDRYQSISSDGVSTYANA
AQNSERAIRQQLTDDPRFGPQKADEFIQYMKSELSNTNEPYQSRVDKADQWLNENKR
NT seq 3954 nt   +upstreamnt  +downstreamnt
atggattacaacatatataccctgggtgatattgattttgtctggtcggcttttaccggt
attgccctaatcttttctcaatatactggtgtaaaagagttcctgaccacggccgccgtt
gtagcaggtgtgagcctattctataaaacgtggctatggcttcaggctccgaccaaaaat
gaattaccgtttttctcctggtttttggggttgatccttttcatgatggcaatggttcga
gtggatgtaactattgaatctgtaaagtcgggagaggtcagaaacgtcgacggaattcca
atttttattgctgcgatggccaccgtcaccactaacttaagccagggtttgctgaaggat
tataaaactgcgtttgatccgctttctccggtggacctgtctgcaacaactctggacgat
gacatcaccctcggtccgatgatccgattcgtgaagtttttgcaatggggcggcgatagc
cagggctactgttctgcatttcctgaaccggccagcgggctagggccaatgaacgtatgt
gctaccgttcagtctcttgcatacaactgcctgaaggctacccaaaactcaagcgcaaat
attgccggtaaagaaactatttttaacgatattttctcagctaatctggcagatagcatg
gaccggattaatcaggcgatgaaaggcgcactgaagaatgcctctgccagtattgttggc
gctaacggttcaaaatctggtacgtgtgatgaggtctggtcaactgtgaaacaggttacc
agtacagctgaagctcgccagactatttcccttataggacagacaaacggcatccttact
ccagacgaagcaaatggtgcacctaccggcgcaagctttactgatgttatggcgtcagca
aatggtatgtacggtaaggctattggttcgtatgacgccaccctgaacctgttcataatg
aatgagctcagaaatggcgcaagcaaatataagaccccactcggtctggcttccgatatg
cagttgtttgaggcttctctgaagcgaaccaacacaatggcttcacagggccagttgtgg
ttacaactgtcgggagcagcaatcgcattccttgaaatgtttgcttatatggttgctcca
tttgctttgcttatgctgctggcgttaggtggtaatggtgttgcagctgcggcgaaatat
ttgcaacttatcctcttcgtgaatatgtggccgcttacggcagtaatggtcaacgcgtat
gtgaagaaagtcgcgacggccgacttggatacctggagcaccctcaacagccagaataat
gccgtcacgtggatgggactcccagggcttgcggaaacatacagttcatacctgtctgtt
gcttccgccctctatgctctgattccggtactcacattattcctgatgacacagtcgatt
cacccgatgatgaatgcggttaagggagtgacccccgatgcgccggtggatactggtcat
gtaacgcccaaagtatgggatggccctaacagcggtaaatcttcatttggtgacgtgaca
cgaaccgccttaaccagtaccggtcagggatacagcgatggcggcgcagttgattcaagt
aatttccgtcttggaatgtggaatgctggttcaagtatcgctaacagccaggggcaagga
tcagctgtaacctcatcagttatgagtgcggcaagtaattcattccaggctggttacagt
cagatgagcgaaattggaaggtcaggacagtcgagccagcagttctcaaccaacctgcaa
acaatgaagcagatctcggataagattggtgcctctgtagcagaaggtattgcaacgaaa
catggggtgagtgcgtctcagatggccagcattgcttcaaatgttattctcaacgctggg
cttaatggaggtgctggaactggcaatggagccgggctgaaagcggctgtagcagggcaa
ttgagtagcggtgcatctaagaccaatacaggcagtgactcgctttcaaatgacctttca
aaagcaatcacgaatcagcttagccaggattctgcgttaactgaccagttcagtaaagcg
gcgtctcaggtaagcagcgatcagatatccaatactaatgcgtttaaagaagcatcgtcg
aaaatgaaccaggcgacacagacgatggcgcaaaatatttctacatcggtttcgactaac
gcaagctccaatagtggaatgagccttgattctaaacaaagcattaacctggacaggttc
tccgattctattcgcaacaaaaacttcagtgatgatgatgtaaggaattttgctcgtaag
aatgggctggatgagaatgcgtttatggagaaattcaactcctataacgataccttcaag
gccagtaatcagcttggatcgcagcttcaacgtactgacgcgcttgtggctgcaacacga
gatttcagtgagcaaaaaattgcgattgataccgcccggggagagacggccgaaagtaat
aaacaggatctccgtgaaacctccagcctgcttaaaagtctggtttccgacttcggtggt
aatgcacagcagctgctacctatcaccaatcagctcgacagaatttcaggcgacgggtca
ggaattaatactatcactcaggcacaggatagaactcctgacagcgtaaatacgtctggc
gtgatgagtgcgtcacgcgtaggggaactgggtggaagtgtagattcgcaggctaaactc
ggtctttcctccaacgctcaggacgcgacacagcgtgtccctggaaaaagtgaagctggc
tttactccgtataaccttgataacgcgggcaaaggcgatattcagggaatacataacaac
aacgtgggccgcacttattctgatgaagaaaggaatgtgctcaattctctcaaaacgaat
ggccctgtactgaataatcagggtgtagagaaagtcgtcaattcaggtcaggatgtcaga
aatgcagaaggcacatttaacgatctggaaaaggctaccggaggtcgggtggttggtgat
ggaatggatcaacgagccactgctttgaacagtatgtatcagagcggtcaagttcgtggc
ttatctaataacactgataactactttagtcgtgttgccaacaacccgaacttaagccgg
gacgataagcgagctgaattggcacagcaagctgtctttacctatggtgccagcaccatg
gctaccggtgccgaaagagagcagctcaaagcggatacccagaagatccttaatgaactg
ggtaactataacgttaactggagtatgaatgacgttcagagcatccatagcagtttcaac
actcataacagagctgatggttcacttgagtcagtcgtacgggcaaacctaggagagggt
gggtcgggcggtggtctcgttggtaaccgcactcagaccgtcacagatcgcttggttggg
gaaaagatagaggccaacactgagcggggcgcgatttctggtgcgctactcgggggccag
caatttgtttcggatacgctaaccagcgttggggcgaaaccggtaaatgagatgcttacg
ggagcgggcatccttcaaacccagacatcgatagcaaatgatgcctctaaccctgcaaat
atgcctgattctctccagggtaaagtccttaatcacatgcagatgtctgatggcgtcgca
gctgtaagtgaccggtatcagagtattagcagcgacggcgtttcgacttatgcgaatgca
gcgcagaactctgaaagggctatccggcagcaattgacggatgacccacgctttgggcct
cagaaagcagatgaattcattcagtacatgaagtcagagctgagcaacacaaatgagcct
taccagtcacgtgtcgataaagcggatcagtggcttaatgaaaataaaaggtag

DBGET integrated database retrieval system