KEGG   Escherichia coli APEC O1 (APEC): APECO1_O1R146
Entry
APECO1_O1R146     CDS       T00425                                 
Symbol
trhH
Name
(GenBank) pilus assembly protein
  KO
K12072  conjugative transfer pilus assembly protein TraH
Organism
ecv  Escherichia coli APEC O1 (APEC)
Brite
KEGG Orthology (KO) [BR:ecv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecv02044]
    APECO1_O1R146 (trhH)
Secretion system [BR:ecv02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   APECO1_O1R146 (trhH)
SSDB
Motif
Pfam: TraH HSBP1
Other DBs
NCBI-ProteinID: ABF67831
UniProt: A0A0H2XLT5
Position
pAPEC-O1-R:complement(166261..167739)
AA seq 492 aa
MTCLRPIRSIISMLAAVLEALMRSNAVFNFKKLLLSLSVCAAILAPTANADNAMRNIFNG
MMTSTSPATFSTATRTGIVGGSMSYRTTNVNTNLVSMSFPKASVGCNGIDVFLGSFSMIN
GDQLVQVARGIAQGAAIYAFNVAVSAICADCAATINDIQNKLQALNKFAKDSCNATYSFL
SENVGTPSQFANSVSSGPASILGSINGLIPDFGSSMTKSPEAVTSQVKAKDPEEFAEKFS
GNLFYMSFMDIDKGTMNIGGVTELSGYKLAEQLMSLVGTVIINWDSKGEKAGMEVRPSTM
TVTDYIMGPPAGGSIKMLKCSPAPDPSSPRKAQCLVMSEVNDGGFKGLKDTISDLLLNVQ
KKIINDVRVSDDELRIISYIGIPTIIDSLQTFEAPEGYAYIQDISTIAATSLVINMLRQV
EAKISTMSIPSESLSGKRDDLNRLTDNLSKQVKAAYELSHSQVGTSSDVISTWDNRRLQR
KAFTESIRGTRN
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgacatgcctacggccgatccggtcaattatctcaatgctggcggcagttttggaggca
cttatgcgcagtaatgccgttttcaacttcaaaaagttacttttgtctctttctgtttgt
gctgcaattttagccccgactgcaaatgcagacaacgcaatgcgtaacattttcaatggc
atgatgacgtctaccagcccggccaccttttccacagcaacccgtacaggcatagttggc
gggtcaatgtcttaccgaacaacaaacgttaataccaaccttgtttccatgtcgtttcca
aaagcttctgtcggttgtaatggtattgacgtttttcttgggtccttcagcatgatcaac
ggggaccagcttgtgcaggtggcccgtggtattgcccagggtgcggctatctatgctttt
aacgttgctgtttcagctatttgtgctgactgtgctgcaacgattaatgacatccaaaac
aaactgcaagcgctaaataaatttgcgaaagattcatgcaatgcaacttactctttcctt
tctgaaaacgtgggtacgccaagccagttcgctaactcagttagctctggaccagcctca
attctgggatcgattaatggtctcattcctgattttggctcatcgatgacaaagtcacct
gaagctgtcacttctcaggttaaagcaaaggatcccgaagagttcgctgaaaaattcagt
ggtaacctcttctatatgtcgttcatggatattgataagggaacaatgaacatcggaggg
gtaacggagttatccggttataaattggcagaacaacttatgtctctcgtgggtactgtc
attatcaactgggatagcaaaggcgaaaaagcgggaatggaagtccgcccgtctaccatg
actgtcacggattacatcatggggccaccagctggcggatcaattaaaatgctcaagtgt
tctccggcaccagatccatcatccccacgaaaggctcagtgccttgtcatgtcagaagtt
aatgacggtggttttaagggattgaaggataccatttctgatcttcttttaaacgtacag
aaaaaaatcatcaacgacgttcgtgtttcagatgatgaattacgcattatctcctatatc
ggcatcccgaccattatcgactctttgcaaacattcgaagcaccggaagggtacgcatac
attcaggacataagcactattgctgcgacgagcctcgtaatcaacatgttgcgccaggtt
gaggccaaaatttcaaccatgagcataccgagtgagtcgctgtcgggtaaaagggatgat
ctcaaccgattaacagacaatctctcaaaacaggttaaagccgcctatgagctatcgcac
agccaggtcggtaccagctcggacgtcatttcaacctgggataaccgtcgcctgcaacgg
aaggctttcactgaaagtattcgtggcacacgtaactga

DBGET integrated database retrieval system