KEGG   Escherichia coli APEC O1 (APEC): APECO1_O1R28
Entry
APECO1_O1R28      CDS       T00425                                 
Symbol
trhU
Name
(GenBank) TrhU
  KO
K12060  conjugal transfer pilus assembly protein TraU
Organism
ecv  Escherichia coli APEC O1 (APEC)
Brite
KEGG Orthology (KO) [BR:ecv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecv02044]
    APECO1_O1R28 (trhU)
Secretion system [BR:ecv02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   APECO1_O1R28 (trhU)
SSDB
Motif
Pfam: TraU ASXH DUF3852
Other DBs
NCBI-ProteinID: ABF67711
UniProt: A0A0H2XJK4
Position
pAPEC-O1-R:33062..34222
AA seq 386 aa
MADAKLSGPDEKLFYQSRRLYRKCCNIYYIQVSMMVKKFKKLLLEFIVAVMLSLSIPGMA
MAADAGVPGAMCQSAGVWQGLIKNICWSCIFPMRIMGIGAAPEGAAPSRPGCYCTDQNGV
PEIGWQLSFFQPVKIVEVVKSPWCSPFLEGTMLQKSQFDIGKSNTNQPMTATEAGFYDVH
LWEFPIMTMLKLLIIGECTAEPYIDASLTYISEVDPMWESDLLTLVLNPEAVVFANPIAS
MVCAADCVAVTAGKDNLAAYFCAGCDGNLYPLTGHIYANDDAVRTSSLITQRLLTKLHRQ
GMLMRTMGADAMCEKTWEYFTPRSQYRLSMLFPTPEAKGPDCCHRLGDSVHDWSTLKGGR
KKIGNDNYVYMLWRYNDCCVRYVPGV
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggctgacgctaaattatccggaccagatgagaagttattttaccaaagccgtcgacta
tatcgaaagtgttgcaacatttattacatccaagtgagcatgatggtgaaaaaattcaaa
aagttacttttagagttcattgtagcagttatgctttcgctttctatacctggtatggct
atggcagcagatgctggagtccctggggctatgtgtcagtcagctggagtgtggcagggc
ttgattaagaatatctgttggagctgcatttttcccatgaggataatgggcataggggct
gctccagaaggcgctgcaccttcacgtccgggttgctactgcacagatcagaacggcgta
ccggaaataggttggcaattgagcttctttcagccggtgaagattgtagaagttgtaaag
agcccctggtgcagcccctttcttgaaggcacgatgcttcaaaaatcgcagtttgatatt
ggtaaaagcaacactaatcagccaatgacagcaactgaagccggattttacgatgttcat
ctttgggagttcccaatcatgacaatgctcaaattactgattattggcgagtgcactgct
gaaccctatatagatgccagcctgacctatataagcgaagtggaccctatgtgggaaagt
gatctgcttacactcgtcctgaatcccgaggcagtagtttttgcaaacccaattgcctca
atggtgtgcgctgctgactgtgtagcagtaacagcaggaaaggataatctcgctgcatac
ttttgtgccggatgcgatggcaacctttacccattaaccggccacatttacgcaaatgat
gacgctgtaaggacgagttcactgattacccagcgtcttctgacaaaactacatcgccaa
ggcatgctgatgcgaacgatgggagcagacgcaatgtgtgagaaaacgtgggaatacttt
acaccacgttcccagtatcggctttcaatgcttttccctactcctgaggcgaagggaccg
gattgctgtcatcgtcttggtgattcggtacacgactggtcaacccttaaaggtgggcgc
aaaaaaataggcaacgataattatgtctatatgttgtggcgttacaatgactgttgtgtt
cgctacgttccgggcgtttga

DBGET integrated database retrieval system