KEGG   Escherichia coli APEC O1 (APEC): APECO1_O1R5
Entry
APECO1_O1R5       CDS       T00425                                 
Symbol
trhK
Name
(GenBank) TrhK
  KO
K12066  conjugal transfer pilus assembly protein TraK
Organism
ecv  Escherichia coli APEC O1 (APEC)
Brite
KEGG Orthology (KO) [BR:ecv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecv02044]
    APECO1_O1R5 (trhK)
Secretion system [BR:ecv02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   APECO1_O1R5 (trhK)
SSDB
Motif
Pfam: TraK
Other DBs
NCBI-ProteinID: ABF67688
UniProt: A0A0H2XK23
Position
pAPEC-O1-R:3543..4817
AA seq 424 aa
MMIKKKGLGFNAITALIMLTTSNCVIAEEYQLPATINNPVVMPVGADGFQNGAAKAIIPG
QAGSEQSGAQTNLSEAGNAQGQKPTTDLPTVQLSPASNASPAVSAITGALSNNPSLPGFD
AQTRSGAIDSYGRPTGTSSQQNATNATATSKADELYVEARNRYKEVQRVNVPPGGNVVLP
VSRGLQNRISTSFKNASVSTSTPAEEASIFVNGGDVFISTNTDKPIGIMLSEDQVPESTY
NLTLVPLDVPGAMISVTTSLSPSMQAKRETSLDKQNYEEMLARSQSEELAPSDPKQDDHK
QRIIDLLTPVALGEVPSGFSLQQDRLSRIPASEQSPCNFNMYAKLGQRLVGSRELIDVIL
VKNDKPYGQIVADQQCMAEGVIASALFDKAYLQPGEETELYIVRDKLFKEREARVTTRPS
LIRK
NT seq 1275 nt   +upstreamnt  +downstreamnt
gtgatgattaaaaaaaagggcttagggttcaacgcaattaccgcattgatcatgctcacg
acttcgaactgcgtaatcgctgaagaataccaattgccagcaacaattaataacccggtt
gtaatgccagttggtgctgacggatttcagaatggagctgcaaaagccattattccgggt
caagctggttctgaacagtcaggtgcacaaacaaaccttagtgaagccggtaatgcgcag
ggacaaaaacctacaactgatctccctaccgtgcaactttccccagccagcaatgcttcg
cctgcggtaagcgctattactggagcattatcaaataatcctagtctccccggatttgac
gcacagacccgctctggtgcaattgatagctatgggagaccaacaggtacctcttcccag
cagaatgcaaccaatgcgaccgccacgtcaaaagccgatgaactttatgtcgaagctcgt
aaccgatataaagaagttcagcgtgtaaatgtgccgcctggtgggaatgtggtactgcca
gtttcacgaggacttcaaaacagaatatcgaccagcttcaagaatgcttctgtcagcact
tctacccctgctgaagaggcaagcatatttgttaatggtggcgatgtctttatttcaact
aataccgataaaccaatcgggattatgttgtcggaagatcaggtacctgaatcgacctat
aacctgaccctggtaccgcttgatgttcccggtgcgatgatttcagttactacatcttta
agcccatctatgcaagccaaacgtgaaacctcattggataagcaaaactatgaggaaatg
ttggcccgctcccagtcagaagaactggctccatcggatccaaaacaagacgatcataaa
caaagaatcattgatttattgactcctgtggctcttggtgaggtcccttcaggattcagt
ttacaacaggaccgactttctcgtattcctgcgtcagagcagtccccatgtaactttaat
atgtatgcaaagctcggtcagagactggttggctcacgtgaacttattgatgtaattctt
gtgaaaaacgataaaccatacggtcaaatcgttgctgatcagcagtgtatggcagaaggc
gttattgcaagtgctttatttgataaagcatacctgcaaccgggagaagaaacagagctt
tacatagtccgggataaattgttcaaggaacgcgaggcccgggttacaaccagaccaagt
ctaatcagaaaataa

DBGET integrated database retrieval system