KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_0229
Entry
EcE24377A_0229    CDS       T00590                                 

Definition
(GenBank) ImpA domain protein
  KO
K11910  type VI secretion system protein VasJ
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Brite
KEGG Orthology (KO) [BR:ecw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecw02044]
    EcE24377A_0229
Secretion system [BR:ecw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EcE24377A_0229
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N FAM86
Other DBs
NCBI-ProteinID: ABV18177
UniProt: A7ZHV9
Position
complement(247338..248750)
AA seq 470 aa
MAMDLRDPNVWISHLLENLPEEKLASALKDDNPNWEYIDGEIVKLGSLAHSQLDIPELQR
RGLVILASESKDFRLLAHLLRTLQHAGDPHLALRLLALYVEHYWAVAAPQNMAHKKRFAS
QVIKRFETGIEVFSQNAATAQRDALSGELAKLAQCWQSHNAPELAQATDDLFALYQRAFN
RAAPAPVPTPAASGSSPQTTATSESGVTQPSAPAPQIVIDSHDDKAWRDTLLKVAAILCE
RQPDSPQGYRLRRHALWQNITSTPQAESDGRTPLAAVSADMVADYHAQLGSADMALWQQV
EKSVLLAPYWLDGHCLSAQTALRLGYKQVADAIRDEVIRFLERLPQLTGLLFNDHTPFIS
EQTKQWLAASPDAKVAPVAQIGEESKAARACFAEQGLEAALRYLDMLPEGDPRDQFHRQY
LAAQLTEEAGLVQLAQQQYRMLFRMGLQMMVADWEPSLLEQLEQKFTAEQ
NT seq 1413 nt   +upstreamnt  +downstreamnt
atggcaatggacttacgcgatccgaatgtctggatatcgcacctgctggaaaacctgccg
gaagagaaactggcatcggcgctgaaagatgacaacccgaactgggagtatatcgacggc
gaaatcgtcaagctgggatcgctggcccacagtcaactggatatcccggaactccagcgc
cgtgggctggtcattctggcttcggagagtaaggattttcgtctgctggcgcatctgctg
agaaccctgcaacacgccggtgatcctcatctcgcattgcgcctgctggcgctgtatgtg
gagcattactgggcggtggctgcgccgcagaatatggcgcataaaaaacgctttgccagc
caggtcattaaacgctttgaaacaggtattgaagttttttcacagaacgccgccacagcg
cagcgcgatgcgctgtcaggggaactggcaaaactggcgcaatgctggcagtcacataac
gccccggaactggcacaggctactgatgatctttttgccctgtaccagcgtgcgtttaat
cgtgcggcaccggctcctgtccccactccggcggcctccggtagttcaccacagaccacc
gccacgtctgaaagcggcgtgacgcaacccagtgctccggctccccaaatcgtcatcgac
agtcacgacgacaaagcctggcgcgacacgctgttaaaagtggcggccattttatgtgaa
cgccagccggattcaccgcagggctaccgtctgcgccgccatgcgctttggcagaacatc
accagtacgccccaggcggaaagcgatggccgtactccactggctgcggtctccgccgat
atggtggcagattaccatgctcagctcggtagtgccgatatggcgctgtggcagcaggtg
gagaaaagcgtactgctggctccttactggctggatggtcactgcctttctgcacagacg
gcgctgcgtctgggttacaaacaggtggcagacgccatccgcgatgaggtcatccgcttc
cttgagcgtctgccccagcttaccgggctgctgtttaatgaccacacaccgtttatcagt
gagcagacgaaacaatggctggcagcttcgcccgacgccaaagttgcaccggttgcgcaa
atcggtgaggaatcgaaggcagccagagcctgttttgctgagcagggtctggaggcggcg
ctgcgatatctggacatgctacccgaaggcgatccccgcgatcagtttcaccgccagtac
cttgccgcacagttgacggaagaggcggggctggtacagcttgcgcagcagcagtaccgg
atgttgttcaggatgggattgcagatgatggtggcagactgggagccgtccctgcttgag
cagctagaacaaaaattcacggcagaacaataa

DBGET integrated database retrieval system