KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_0235Help
Entry
EcE24377A_0235    CDS       T00590                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11894  type VI secretion system protein ImpI
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Brite
KEGG Orthology (KO) [BR:ecw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecw02044]
    EcE24377A_0235
Secretion system [BR:ecw02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   EcE24377A_0235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FHA
Motif
Other DBs
NCBI-ProteinID: ABV20875
UniProt: A7ZHW5
Position
complement(254884..256164)
Genome map
AA seq 426 aa AA seqDB search
MPEEKLQTLSLQVINGSELESGRAARCLFTQQGNVGHAPECHWSVQDRQHSIPAQAFTII
LHDGTFCLRPQTAQLWLNQAKVTATSDLIQLRQGDEIQIGRLMVRVHLNRGDIPHYDEEM
ATPETIVTNRDMLTDTLLSTEGTPHYPGMTHRHQLADTVVNGFSADPLQALQSESLITTG
DPLSGIAAVRPSAPLSDPASNGGINTPFMDLPPIYASPGDRNDDVSAAEMAQRHLAVTPL
LRGLGGSLTMSNSDDADDFLEEAGRTLQAAIKGLLDLQQQRNSLSDKHLRPLEDNPLRLN
MDYATALDVMFAEGKSPVHLAAPAAVSESLRNVRHHEEANRAAIVESLRVLLDAFSPQNL
LRRFVQYRRSHELRQPLDDAGAWQMYSHYYEELASDRQQGFEMLFNEVYAQVYDRVLREK
QREPEA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgccggaagagaaactacagacgctttcattgcaggtcattaacggcagtgagctggaa
agcgggcgggcggcgcgctgtctgttcacacagcagggaaatgtcggccatgcccccgaa
tgccactggtcggtacaggatcgtcagcatagcattccggcccaggcttttaccattatc
ctgcacgatggcacattttgtctgcgcccgcagacggcacaactgtggctgaatcaggca
aaagtcacagcaacatcagacctaatacagttgcgccagggcgatgagatccagatcgga
cggctgatggtgagggttcatctgaaccggggagatattccccattacgatgaggaaatg
gccactcccgaaaccatcgttaccaatcgcgatatgctcacggataccctgctatcaacg
gagggtacgccacactatccgggaatgactcaccggcaccagcttgcagacaccgtggta
aacggtttttctgccgatccactccaggcacttcagtccgaaagcctgattaccacgggc
gatccgctttcaggcattgcggctgtccggccatcggcaccgctgtccgatccggcaagt
aatggggggatcaatactccgtttatggatctgccgcccatttatgccagccccggcgat
cgtaatgacgacgtctctgcggcagaaatggcgcaacgccaccttgcggtcaccccctta
ctgcgcggtcttggcggctcgcttaccatgagcaattccgacgatgcggatgattttctg
gaggaggccggacgaacgttacaggccgcaataaaaggtctgctcgatttgcagcagcag
cgtaacagcctctcagacaaacatttgcgcccgctggaagataacccgctgcgcctgaac
atggattacgccaccgcgctcgacgtaatgtttgccgaaggtaaaagcccggtacatctg
gcggctcccgccgccgtcagtgaaagcctgcgcaatgtccgccaccacgaagaagctaac
cgggcagcgattgtggagtcgcttcgtgtcctgctggatgctttctcaccacaaaatctg
ctgcgccgctttgtgcagtaccgccgcagccatgaactgcgccagccgctggatgatgcc
ggagcatggcaaatgtacagccattattacgaagaactggcctccgatcgccagcagggg
tttgagatgctgtttaacgaggtctacgcccaggtctatgaccgggtgcttcgtgaaaaa
cagcgggagccggaagcatga

DBGET integrated database retrieval system