KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_0246
Entry
EcE24377A_0246    CDS       T00590                                 

Definition
(GenBank) Rhs protein
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
SSDB
Motif
Pfam: RHS_repeat RHS
Other DBs
NCBI-ProteinID: ABV20272
UniProt: A7ZHX6
Position
265437..269684
AA seq 1415 aa
MGGKPAARQGDMTRKGLDIVQGSAGVLIGAPTGVACSVCPNSPIEEQKGNPVNPLLGAKV
LPGETDLALPCPLPFILSRAYSSYRTRTPAPVGVFGPGWKAPFDIRLQVHERELILNDSG
GRSIHFEPLFPGEISYSRSESLWLARGGVAAQHSSQPLSALWQVLPEDVRLSPHVYLATN
SLQGPWWILSWPERVPGADEVLPPEPPAYRVLTGVVDGFGRTLAFHRAAEGDVAGAVTGV
TDGAGRRFHLVLTTQAQRAEVFRKQRATSLSSPAGPRSASSSLVFPDTLPAGTGYGTDNG
IRLEAVWLTHDPAYPDEQPTAPLARYTYTAGGELRAVYDRSGTQVRGFTYDAEHAGRMVA
HHYAGRPESCYRYDDTGRVTEQVNPEGLDYRFEYGESRVIITDSLNRREVLYTEGEGGLK
RVVKKEHADGSITRSEYDEAGRLKAQTDAAGRRTEYSLHMASGAVTAVTGPDGRTVRYGY
NSQRQVTSVTYPDGLRSSREYDEKGRLTAETSRSGETTRYSYDDPASELPTGIQDAMGST
KQMAWSRYGQLLAFTDCSGYTTRYEYDRYGQQIAVHREEGISTYSSYNPRGQMVSQKDAQ
GRETPYEYSAAGDLTATVSPDGKRSTIAYDKRGRPVSVTEGGLTRSMGYDAAGRITVLTN
ENGSQSTFRYDPVDRLTEQRGFDGRTQRYHYDLTRKLTQSEDEGLITLWHYDASDRITHR
TVNGDPAEQWQYDEHGWLTTLSHTSEGHRVSVHYGYDDKGRLTGERQTVENPETGELLWQ
HETKHAYNEQGLANRVTPDSLPPVEWLTYGSGYLAGMKLGGTPLVEYTRDRLHRETVRSF
GSRAGSNAAYELTSTYTPAGQLQSQHLNSLVYDRDYGWNDNGDLVRISGPRQTREYGYSA
TGRLESVRTLAPDLDIRIPYATDPAGNRLPDPELHPDSTLTAWPDNRIAEDAHYVYHYDE
YGRLTEKTDRIPTGVIRTDDERTHHYHYDSQHRLVFHTRIQHGEPLVESRYLYDPLGRRM
AKRVWRRERDLTGWMSLSRKPEETWYGWDGDRLTTVQTDTTRIQTVYQPGSFAPLIRIET
DNGEREKAQCRSLAEKIQQEGSEDGHGVVFPAELVGLLDRLEGEIRANCVSSESRQWLAQ
CGLTVERLAAQIEPVYLPERKIHLYHCDHRGLPLALISEDGNTAWSAEYDEWGNQLNEEN
PHHLHQPYRMPGQQYDKESGLYYNRHRYYDPLQGRYITPDPIGLRGGWNMYQYPLNPIQV
IDPMGLDAIENMTSGGLIYAVSGVPGLIAANSITNSAYQFGYDMDAIVGGAHNGAADAMR
HCYLMCRMTKTFGSTIADVIGKNHEAAGDRQGQPAKERIMDLKNNTVGIACGDFSAKCSD
ACIEKYNTGQLFGLDGIKADNPIKAKQGSSDASNY
NT seq 4248 nt   +upstreamnt  +downstreamnt
atgggcggaaaaccggcagcgcggcagggtgatatgacccgcaagggactggatattgtg
cagggttcagcaggggtgctgataggcgcgccgacgggagtggcctgttcggtatgtccc
aacagcccgatagaggagcagaagggtaacccggtgaacccgctgctgggagcaaaggtg
ctgccgggcgagacggaccttgcgctgccctgcccgttgccgtttattctttcccgcgcc
tacagcagttaccggaccaggacgcccgcgccggtgggggtgttcggtcccggctggaaa
gcacccttcgatatccgcttacaggttcatgagcgggaactgatactcaacgacagcggc
ggcaggagcattcactttgagccgctgtttcccggcgagataagctacagccgcagcgag
tcactctggctggcgcggggcggggtggcggcgcagcacagttcgcagccgctaagcgcg
ctctggcaggtgctgccggaagatgttcgcctgagtccgcatgtgtacctggcgacaaac
agccttcaggggccgtggtggatactcagctggccggagcgggtgccgggggcggacgag
gtgctgccgccggagccgcccgcataccgggtgctgacgggcgtggtggacggcttcggg
cggacgctggcctttcaccgggcggcggagggtgatgtggcgggcgcggtgacgggggtg
acggacggcgcgggccgccgttttcacctggtgctgaccacacaggcacagcgggcggaa
gtattccgtaaacagcgcgccacgtctttatcttcccctgccggtccccgttctgcttcc
tcttctctggttttccccgacacgctgcccgccggtacaggatacggcacggataacggt
atccggctggaggcggtatggctgacacacgacccggcatacccggatgaacagccgact
gcgccgctggcgcgctacacgtacacggccggtggtgaactgcgggcggtgtatgaccgc
agcggaacgcaggtgcgcgggtttacttatgatgcggagcacgccgggcggatggtggcg
caccattatgcggggaggccggagagctgctaccggtatgatgataccggtcgggtgacg
gagcaggtcaacccggaggggctggactaccgctttgagtacggagagagccgggtaatc
atcacggacagcctgaaccggcgggaggtgctgtacacggaaggcgagggtggcctgaag
cgggtggtgaagaaggaacatgcggacgggagcattacccgcagcgagtatgatgaggcg
gggaggctgaaggcacagacggatgcggcggggcggcggacggagtacagcctgcatatg
gcgtcgggtgcggtgacggcggtgacggggccggacggcaggacggtacggtatggctat
aacagccagcggcaggtgacgtcggtgacgtacccggacgggcttcgcagcagccgggag
tatgatgagaagggaaggctgacggcggagacctcgcgcagcggtgagacaacgcggtac
agctatgatgacccggcgagtgagctgccgacagggatacaggacgcgatgggcagtaca
aaacagatggcatggagccgttacggtcaactgctggcctttacggactgctcggggtac
acgacgcggtatgagtacgaccggtacggtcaacaaatcgccgttcaccgggaagaaggc
atcagcacttacagcagttataacccgcgtgggcaaatggtcagtcagaaggatgcgcag
gggcgtgaaaccccttatgagtacagcgccgcaggagacctgacagcaacggtatcaccg
gacggtaaacgcagcaccatcgcatatgataaacgcgggcgtccggtgagtgtgacggaa
ggcggtctgacgcgcagcatggggtatgacgctgccgggcgcatcaccgtgctgaccaac
gagaacggcagccagtccacgttccggtatgacccggttgacaggctgactgaacagcgc
ggttttgacggccggacgcaacgttaccactatgacctgaccagaaaactcacacagagt
gaagacgaggggcttatcaccctctggcactacgatgcgtcggaccgcatcacgcaccgg
acggtgaacggcgacccggcagagcagtggcagtatgatgagcacgggtggttaaccacc
ctcagccataccagtgaaggccaccgcgtgtcggtccactacggctacgacgataagggc
cgcctgacgggcgaacggcagacggtggagaacccggagacgggggaactgctgtggcag
catgagacgaaacacgcctacaacgaacaggggctggcaaaccgcgtcacgccggacagc
ctgccgccggtggagtggctgacctacggcagcggttacctggcgggcatgaagctgggc
gggacgccgctggtcgagtatacgcgggacaggctgcaccgtgagacggtgcgcagcttc
ggcagcagggcaggcagtaatgccgcatatgaactgaccagcacatacacccccgcaggc
cagttacagagccagcacctgaacagcctggtgtatgaccgtgactacgggtggaatgac
aacggcgacctggtgcgcatcagcggtccgcgacagacgcgggaatacggctacagtgcc
acgggcaggctggagagcgtgcgcaccctcgcaccggacctggacatccgcatcccgtat
gccaccgacccggcgggaaaccgcctgccggacccggagctacacccggacagcacgctc
acggcgtggccggataaccgcatcgcagaggatgcgcactatgtttaccactatgatgaa
tacggcagactgacggagaagacggaccgcatcccgacgggtgtgatacggacggacgac
gagcggacccaccactaccactacgacagccagcaccgcctggtgttccacacgcggata
cagcatggcgagccactggtcgagagccgctacctctacgacccgctgggacggcgaatg
gcgaaacgggtatggcggcgggagcgtgacctgacggggtggatgtcgctgtcgcgtaaa
ccggaggagacatggtacggctgggacggcgacaggctgacgacggtacagaccgacacc
acgcgtatccagacggtataccagccggggagcttcgcgccgctcatccgcatcgaaaca
gacaacggtgaacgggagaaagcgcagtgccgcagcctggcggagaagatacagcaggaa
gggagcgaagacggtcacggtgtggtgttcccggctgaactggtggggctgctggacagg
ctggagggggaaatccgggcaaactgcgtgagcagtgaaagccgccagtggcttgcgcag
tgcgggctgacggtggagcggctggcggcacagatagagccggtttatttgcctgagcga
aaaatacatctttatcactgtgaccaccggggcctgccgctggcgcttatcagtgaagac
ggcaatacggcgtggagcgcggaatatgatgaatggggcaaccagcttaatgaggagaac
ccgcatcacctgcaccagccgtaccggatgccggggcagcagtatgataaggagtcgggg
ctgtactataaccgtcaccggtactacgatccgttgcaggggcggtatatcaccccggac
ccgattgggttgagaggtggatggaatatgtatcagtatccgttgaatcccatacaagtg
atagacccaatggggttagatgcgattgagaatatgacatcaggtggactaatttatgcc
gtatctggtgtacctggattgattgctgcaaacagcattactaacagtgcttaccagttc
ggttatgatatggatgctattgttggcggagctcataatggggccgccgatgcaatgaga
cattgttacttgatgtgtcgaatgactaagacatttggatcaacaatagctgacgtgata
ggtaaaaatcatgaggcggcaggggatagacaaggtcagccagctaaagaaagaatcatg
gatcttaaaaataacactgtcggtattgcttgtggcgatttttctgccaaatgtagcgat
gcatgtattgaaaaatataacactgggcaactcttcgggttagatggtataaaagcagat
aatccaataaaagcaaagcaagggagttcagatgcttcaaattattag

DBGET integrated database retrieval system