KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_0782Help
Entry
EcE24377A_0782    CDS       T00590                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
ecw00010  Glycolysis / Gluconeogenesis
ecw00260  Glycine, serine and threonine metabolism
ecw00680  Methane metabolism
ecw01100  Metabolic pathways
ecw01110  Biosynthesis of secondary metabolites
ecw01120  Microbial metabolism in diverse environments
ecw01130  Biosynthesis of antibiotics
ecw01200  Carbon metabolism
ecw01230  Biosynthesis of amino acids
Module
ecw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ecw_M00002  Glycolysis, core module involving three-carbon compounds
ecw_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ecw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcE24377A_0782 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    EcE24377A_0782 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EcE24377A_0782 (gpmA)
Enzymes [BR:ecw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EcE24377A_0782 (gpmA)
Membrane trafficking [BR:ecw04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    EcE24377A_0782 (gpmA)
Exosome [BR:ecw04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EcE24377A_0782 (gpmA)
  Exosomal proteins of melanoma cells
   EcE24377A_0782 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: ABV17240
UniProt: A7ZJD0
Structure
PDB: 

Position
complement(806308..807060)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLMYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggttcgtcatggcgaaagtcagtggaacaaagaaaac
cgcttcaccggttggtacgacgtggatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggtaagctgctgaaagaggaaggttacagctttgactttgcttacacctctgtgctg
aaacgcgctatccataccctgtggaatgtgctggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactgaacgaacgtcactacggtgcgttgcagggtctgaacaaa
gcagaaaccgctgaaaagtatggcgacgagcaggtgaaacagtggcgtcgtggttttgca
gtcactccgccggaactgactaaagatgatgagcgttatccgggtcacgatccacgttac
gcgaagctgagcgagaaagaactgccgctgacggaaagcctggcgctgaccattgaccgc
gtgatcccttactggaatgaaactattctaccgcgtatgaagagcggtgagcgcgtgatc
atcgctgcacacggtaactctttacgtgcgctggtgaaatatcttgataacatgagtgaa
gaagagattcttgagctgaatatcccgaccggcgtgccgctgatgtatgagttcgacgag
aatttcaaaccgctgaaacgctattatctgggtaatgctgacgagatcgcagcgaaagca
gcggcggttgctaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system