KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_1596Help
Entry
EcE24377A_1596    CDS       T00590                                 

Gene name
aldA
Definition
(GenBank) aldehyde dehydrogenase A
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
ecw00620  Pyruvate metabolism
ecw00630  Glyoxylate and dicarboxylate metabolism
ecw01100  Metabolic pathways
ecw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EcE24377A_1596 (aldA)
   00630 Glyoxylate and dicarboxylate metabolism
    EcE24377A_1596 (aldA)
Enzymes [BR:ecw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     EcE24377A_1596 (aldA)
    1.2.1.22  lactaldehyde dehydrogenase
     EcE24377A_1596 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF1487
Motif
Other DBs
NCBI-ProteinID: ABV16627
UniProt: A7ZLL1
Structure
PDB: 

Position
1588203..1589642
Genome map
AA seq 479 aa AA seqDB search
MSVPVQHSMYIDGQFVTWRGDAWIDVVNPATEAVISRIPDGQAEDARKAIDAAERAQPEW
EALPAIERASWLRKISAGIRERASEISALIVEEGGKIQQLAEVEVAFTADYIDYMAEWAR
RYEGEIIQSDRPGENILLFKRALGVTTGILPWNFPFFLIARKMAPALLTGNTIVIKPSEF
TPNNAIAFAKIVDEIGLPRGVFNLVLGRGETVGQELAGNPKVAMVSMTGSVSAGEKIMAT
AAKNITKVCLELGGKAPAIVMDDADLELAVKAIVDSRVINSGQVCNCAERVYVQKGIYDQ
FVNRLGEAMQAVQFGNPAERNDIAMGPLINAAALERVEQKVARAVEEGARVALGGKAVEG
KGYYYPPTLLLDVRQEMSIMHEETFGPVLPVVAFDTLEEAISMANDSDYGLTSSIYTQNL
NVAMKAIKGLKFGETYINRENFEAMQGFHAGWRKSGIGGADGKHGLHEYLQTQVVYLQS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtacccgttcaacattctatgtatatcgatggacagtttgttacctggcgtgga
gacgcatggattgatgtggtaaaccctgctacagaggctgtcatttcccgcatacccgat
ggtcaggccgaggatgcccgtaaggcaatcgatgcagcagaacgtgcacaaccagaatgg
gaagcgttgcctgctattgaacgcgccagttggttgcgcaaaatctccgccgggatccgc
gaacgcgccagtgaaatcagtgcgctgattgttgaagaagggggcaagatccagcagctg
gctgaagtcgaagtggcttttactgccgactatatcgattacatggcggagtgggcacgg
cgttacgagggcgagattattcaaagcgatcgtccaggagaaaatattcttttgtttaaa
cgtgcgcttggtgtgactaccggcattctgccgtggaacttcccgttcttcctcattgcc
cgcaaaatggctcccgctcttttgaccggtaataccatcgtcattaaacctagtgaattt
acgccaaacaatgcgattgcattcgccaaaatcgtcgatgaaataggacttccgcgcggc
gtgtttaaccttgtactggggcgtggtgaaaccgttgggcaagaactggcgggtaaccca
aaggtcgcaatggtcagtatgacaggcagcgtctctgcaggtgagaagatcatggcgact
gcggcgaaaaacatcaccaaagtgtgtctggaattggggggtaaagcaccagctatcgta
atggacgatgccgatcttgaactggcagtcaaagccatcgttgattcacgcgtcattaat
agtgggcaagtgtgtaactgtgcagaacgtgtttatgtacagaaaggcatttatgatcag
ttcgtcaatcggctgggtgaagcgatgcaggcggttcaatttggtaaccccgctgaacgc
aacgacattgcgatggggccgttgattaacgccgcggcgctggaaagggttgagcaaaaa
gtggcgcgcgcagtagaagaaggggcgagagtggcgttgggtggcaaagcggtagagggg
aaaggatattattatccgccgacattgctgctggatgttcgccaggaaatgtcgattatg
catgaggaaacctttggcccggttctgccggtggtcgcatttgacacgctggaagaggct
atctcaatggctaatgacagtgattacggcctgacctcatcaatctatacccaaaatctg
aacgtcgcgatgaaagccattaaagggctgaagtttggtgaaacttacatcaaccgtgaa
aacttcgaagctatgcaaggcttccacgccggatggcgtaaatccggtattggcggcgca
gatggtaaacatggcctgcatgaatatctgcagacccaggtggtttatttacagtcgtaa

DBGET integrated database retrieval system