KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_1660Help
Entry
EcE24377A_1660    CDS       T00590                                 

Definition
(GenBank) oxidoreductase, zinc-binding dehydrogenase family
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
ecw00010  Glycolysis / Gluconeogenesis
ecw00071  Fatty acid degradation
ecw00350  Tyrosine metabolism
ecw00625  Chloroalkane and chloroalkene degradation
ecw00626  Naphthalene degradation
ecw01100  Metabolic pathways
ecw01110  Biosynthesis of secondary metabolites
ecw01120  Microbial metabolism in diverse environments
ecw01130  Biosynthesis of antibiotics
ecw01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ecw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcE24377A_1660
  Lipid metabolism
   00071 Fatty acid degradation
    EcE24377A_1660
  Amino acid metabolism
   00350 Tyrosine metabolism
    EcE24377A_1660
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EcE24377A_1660
   00626 Naphthalene degradation
    EcE24377A_1660
Enzymes [BR:ecw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EcE24377A_1660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding Methyltransf_25 2-Hacid_dh_C Methyltransf_31 Phage_holin_2_1
Motif
Other DBs
NCBI-ProteinID: ABV18924
UniProt: A7ZLS0
Structure
PDB: 

Position
complement(1655910..1656920)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTKDHHVDVTDKTLRSLKHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCRSVKNAGYSVDGGMAEE
CIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKLSKIRPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLKLATEMGADLAINSRTEDAAKIVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPESMSLDIPRLVLDGIEVVGSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLADINTIFTEMEEGKIRGRMVIDFRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcagttgttacgaaggatcatcacgttgacgttacggataaaacactgcgc
tcactgaaacatggcgaagccctgctgaaaatggagtgttgtggtgtatgtcataccgat
cttcatgttaagaatggcgattttggtgacaaaactggcgtaattctgggccatgaaggc
atcggtgtggtggcagaagttggcccaggtgtcacctcattaaaaccaggcgatcgtgcc
agcgtggcgtggttctacgaaggatgcggtcattgcgaatactgtaatagtggtaacgaa
acgctctgccgttcagttaaaaatgccggatacagcgttgatggcgggatggcggaagag
tgcatcgtggtcgccgattacgcggtaaaagtgccagatggtctggactcggcggcggcc
agcagcattacctgtgcgggggtcaccacctacaaagccgttaaactgtcaaaaattcgt
ccagggcagtggattgctatctacggtcttggcggtctgggtaacctcgctctgcaatac
gcgaagaatgtctttaacgcgaaagtgatcgccattgatgtcaatgatgagcagttaaaa
ctggcaaccgaaatgggtgcagatttagcgattaactcacgcaccgaagacgccgccaaa
attgtgcaggagaaaaccggtggcgctcacgctgcggtggtaacagcagttgctaaagct
gcgtttaactcggcagttgatgctgtccgtgcaggcggtcgtgttgtggctgtcggtctg
ccgccggagtctatgagcctggatatcccacgccttgtgctggatggcattgaagtggtc
ggttcgctggtcggcacgcgccaggatctaaccgaagccttccagtttgccgccgaaggc
aaagtggtgccgaaagtcgccctgcgtccgttagcggacatcaacaccatctttaccgag
atggaagaaggcaaaatccgtggccgtatggtgattgatttccgccgttaa

DBGET integrated database retrieval system