KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_1670Help
Entry
EcE24377A_1670    CDS       T00590                                 

Gene name
pcaI
Definition
(GenBank) 3-oxoadipate CoA-transferase, subunit A
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
ecw00072  Synthesis and degradation of ketone bodies
ecw00280  Valine, leucine and isoleucine degradation
ecw00650  Butanoate metabolism
ecw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    EcE24377A_1670 (pcaI)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    EcE24377A_1670 (pcaI)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EcE24377A_1670 (pcaI)
Enzymes [BR:ecw01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     EcE24377A_1670 (pcaI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: ABV19383
UniProt: A7ZLT0
Position
complement(1665180..1665887)
Genome map
AA seq 235 aa AA seqDB search
MAGLDKRVATYHEALEGLTNEMTILAGGFGLCGIPENLIAEVRHRGVTGLTVVSNNCGVD
GFGLGVLLESRQIRKVVASYVGENALFEKQVLNGELEAILTPQGTLAEQLRAGGAGIPAF
FTATGYGTPVAEGKEVREFNGRPYIMEQAITGDFALVKGWKADWYGNVIYRHTAQNFNPL
MAAAGKITVVEVEEIVPPGELDPAAIHTPGIFVNRVIQGQFEKRIEQRTLSRKGA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggctgggttggataaacgggtcgctacgtatcacgaggcgcttgaaggacttaccaat
gagatgacgattctggcaggaggttttggcctgtgcggcatcccggagaatctgattgct
gaagttcgccaccgtggagtaaccggattaacggtggtttccaataactgtggcgtagat
ggttttggactgggtgtactactggaaagccgacagatccgtaaagtcgtcgcttcttat
gttggcgagaatgctttgtttgaaaaacaggtgcttaacggcgaactggaggcgattctc
acaccacaaggaaccctggcagaacaactgcgcgcaggcggcgcgggtatcccggcgttc
tttactgccaccggttacggtactcccgttgccgaagggaaagaagtccgcgaattcaac
ggtcgcccgtacatcatggaacaggctatcaccggtgattttgccctggtcaaaggctgg
aaagccgactggtacggcaacgtgatttatcgtcataccgcgcaaaacttcaacccactg
atggcggctgccggaaaaatcaccgtggtggaagtggaagaaatagtgccacctggtgaa
cttgatcctgccgctatccataccccggggatttttgttaatcgcgtcattcaggggcaa
tttgaaaaacgcattgaacaacgcacccttagccgcaaaggagcctga

DBGET integrated database retrieval system