KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_2438Help
Entry
EcE24377A_2438    CDS       T00590                                 

Gene name
cdd
Definition
(GenBank) cytidine deaminase
  KO
K01489  cytidine deaminase [EC:3.5.4.5]
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
ecw00240  Pyrimidine metabolism
ecw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    EcE24377A_2438 (cdd)
Enzymes [BR:ecw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.5  cytidine deaminase
     EcE24377A_2438 (cdd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dCMP_cyt_deam_2 dCMP_cyt_deam_1 MafB19-deam Pput2613-deam
Motif
Other DBs
NCBI-ProteinID: ABV17857
UniProt: A7ZNW5
Structure
PDB: 

Position
2420230..2421114
Genome map
AA seq 294 aa AA seqDB search
MHPRFQTAFAQLADNLQSALEPILADKYFPALLTGEQVSSLKSATGLDEDALAFALLPLA
AACARTPLSNFNVGAIARGVSGTWYFGANMEFIGATMQQTVHAEQSAISHAWLSGEKALA
AITVNYTPCGHCRQFMNELNSGLDLRIHLPGREAHALRDYLPDAFGPKDLEIKTLLMDEQ
DHGYALTGDALSQAAIAAANRSHMPYSKSPSGVALECKDGRIFSGSYAENAAFNPTLPPL
QGALILLNLKGYDYPDIQRAVLAENADAPLIQWDATSATLKALGCHSIDRVLLA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcatccacgttttcaaaccgcttttgcccaacttgcggataacttgcaatctgcactg
gaacctattctggcagacaagtacttccccgctttgttgaccggggagcaagtctcatcg
ctgaagagcgcaacggggctggacgaagacgcgctggcattcgcactacttccgctggcg
gcggcctgtgcgcgtacgccattgtcgaattttaatgttggcgcaattgcgcgcggtgtg
agcggaacctggtatttcggtgccaatatggaatttattggtgcgacaatgcagcaaacc
gttcatgccgaacaaagcgcgatcagccacgcctggttgagtggtgaaaaagcgcttgca
gccatcaccgttaactacacgccttgtggtcactgccgtcagtttatgaatgaactgaac
agcggtctggatctgcgtattcatctgccgggccgcgaggcacacgcgctgcgtgactat
ctgccggatgcctttgggccgaaagatctggagattaaaacgctgctgatggacgagcag
gatcacggctatgcgctgactggtgatgcgctttctcaggcggcgattgcagcggcaaac
cgttcgcacatgccttacagtaagtcgccaagcggtgtcgcgctggaatgtaaagacggt
cgtattttcagcggcagctacgctgaaaacgccgcattcaacccgactctgccaccgttg
cagggagcgttaattctattgaatctcaagggttatgattacccggatatccagcgcgcg
gttctggcagaaaacgccgatgcgccgttgattcagtgggatgccacctccgcaacgctg
aaagctctcggctgtcacagtatcgaccgagtgcttctcgcttaa

DBGET integrated database retrieval system