KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_2940Help
Entry
EcE24377A_2940    CDS       T00590                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
ecw00310  Lysine degradation
ecw01100  Metabolic pathways
ecw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    EcE24377A_2940
Enzymes [BR:ecw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     EcE24377A_2940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Mqo Pyr_redox_2 Amino_oxidase NAD_binding_8 Pyr_redox_3 Trp_halogenase Lycopene_cycl FAD_binding_2 Thi4
Motif
Other DBs
NCBI-ProteinID: ABV16531
UniProt: A7ZQ91
Position
2950505..2951773
Genome map
AA seq 422 aa AA seqDB search
MYDFVIIGGGIIGMSTAMQLIDVYPDARIALLEKESGPACHQTGHNSGVIHAGVYYTPGS
LKAQFCLAGNRATKAFCDQNGIRYDNCGKMLVATSELEMERMRALWERTAANGIEREWLN
AVELREREPNITGLGGIFVPSSGIVSYREVTAAMAKIFQARGGEIIYNAEVSALSEHKNG
VVVRTRQGGEYEASTLISCSGLMADRLVKMLGLEPGFIICPFRGEYFRLAPEHNQIVNHL
IYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLAFKREGYRKRDFSFSDTLEILGSSGIRR
VLQNHLRSGLGEMKNSLCKSGYLRLVQKYCPRLSLSDLQPWPAGVRAQAVSPDGKLIDDF
LFVTTPRTIHTCNAPSPAATSAIPIGAHIVSKVQTLLASQSNPGRTLRAARSVDALHAAF
NQ
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtatgattttgtgattattggcggtggcatcatcggcatgtcgaccgccatgcaactg
attgatgtctacccggacgcccgcattgcgttgctggaaaaagagtccggcccggcctgt
caccagacgggccacaacagcggcgtgatccatgccggggtttattacacgcccggtagc
ctgaaggcacagttttgcctggcgggaaaccgcgccactaaagccttttgcgatcaaaac
ggcattcgctatgacaactgcggcaagatgctggtcgccacctctgaactcgaaatggaa
cggatgcgcgcgttgtgggaacgcacggcggcaaacggtatcgagcgcgagtggttaaac
gccgtggaactgcgcgagcgcgaaccgaatatcaccgggcttggcggcatttttgtgccg
tccagcggcattgtcagctaccgcgaagtcacagcggcgatggcaaaaattttccaggcc
agaggcggtgagattatttataacgccgaagtcagcgccctcagtgagcataaaaacggc
gtggtcgtccgaacccgtcagggcggcgaatatgaagcatcgacgctgattagctgttcc
gggctgatggctgaccggctggtgaaaatgctcggcctcgaaccgggttttattatctgc
ccgttccgtggcgagtatttccgccttgcgccggagcataaccagattgttaaccatctg
atttaccccattcccgacccggcaatgccgtttttgggcgttcatctcacccgcatgatc
gacggcagcgtgaccgtcgggccaaacgcggtgctggctttcaaacgcgaaggctatcgc
aagcgcgacttctcatttagcgacacgctggagattttgggctcgtcggggattcgccgg
gtgctgcaaaaccatctacgctcaggactgggcgagatgaaaaactcgctgtgcaaaagc
ggctatctgcggctggtgcaaaagtattgtccccggctttcgttaagcgatctccagccc
tggcccgccggtgtgcgggcgcaggcggtatcgccggacggcaagctgattgacgatttt
ctgtttgtcaccaccccgcgcacgatccacacctgcaatgcgccctccccggcagcgaca
tcagcaattcctattggtgcgcatattgtcagcaaggtacaaacgctgttggcaagccag
agtaaccccggacgcacgctgcgagcggcacgtagtgtggatgccttacacgccgcattt
aatcaataa

DBGET integrated database retrieval system