KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_3123
Entry
EcE24377A_3123    CDS       T00590                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Brite
KEGG Orthology (KO) [BR:ecw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecw02044]
    EcE24377A_3123
Secretion system [BR:ecw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EcE24377A_3123
SSDB
Motif
Pfam: T6SS_VipA GerD Imm65
Other DBs
NCBI-ProteinID: ABV16539
UniProt: A7ZQQ9
Position
3128230..3128730
AA seq 166 aa
MADSFQNEVPAARVNIKLDLHTGNAKKKVELPLKLLAVGDYSNGKEQRPLSERDKIDINK
NNFNSVMAEFSPAVNLTVEDTLSGSGNEQNIALEFKNLKDFEPEQVAKNIPQLRVLLAMR
NLLRDLKSNLLDNATFRRELENILKDPTLSSELRDELAKIAPQENV
NT seq 501 nt   +upstreamnt  +downstreamnt
atggccgacagtttccagaatgaagttcccgccgctcgtgtaaatatcaagcttgacctg
catacaggcaatgctaaaaagaaagttgaactccccctcaagcttcttgctgttggcgat
tacagtaacggaaaagagcaacgtccgctgtccgaacgggacaagattgatatcaataaa
aacaacttcaacagtgtcatggctgagttttcgcctgcggttaatttaacagtagaagac
acactaagcggaagcggtaatgagcaaaatatcgcgcttgaatttaaaaacctgaaagat
tttgaacccgaacaggtagcaaaaaatatcccacagcttcgtgtattactcgctatgcgc
aatttattacgtgacctgaaatccaatctgctggataacgcaacgtttcgccgtgaactg
gaaaatattctgaaagacccgacgctcagttcagaactgcgtgatgaactggcgaaaatt
gcgccgcaggagaacgtttaa

DBGET integrated database retrieval system