KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_3126Help
Entry
EcE24377A_3126    CDS       T00590                                 

Definition
(GenBank) type IV/VI secretion system protein, DotU family
  KO
K11892  type VI secretion system protein ImpK
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
ecw03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ecw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EcE24377A_3126
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecw02044]
    EcE24377A_3126
Secretion system [BR:ecw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EcE24377A_3126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU
Motif
Other DBs
NCBI-ProteinID: ABV18118
UniProt: A7ZQR2
Position
3131679..3132344
Genome map
AA seq 221 aa AA seqDB search
MKKETDINIDALLRDTFLTVVELRQGTTVRHGMELYRHCQRQVELVRERLKDAGFSRESV
EHITYAQCALLDETVLSRSGMDDGQAIWMKDPLQSHFFNTLQAGELLYERMKQVLQEPAP
AQAVLTCFHRVLLLGFRGRYQDPVAPERDQLISTLNGLVAPFGVLPETAVLNVPLSTRQH
PLLHSPFFWLVTLTLLLAGVWWGLHHWLNVLVDELLPQSLR
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagagacggatatcaatatcgacgcgctgctgcgcgacacgtttctgacggtg
gtggaactgcgtcagggaaccaccgtgcgtcacggtatggagctgtatcgccactgccag
cggcaggtcgaactggtccgcgaacgcctgaaagatgccgggttcagccgtgagagcgtg
gagcacattacctacgcgcagtgcgccctgctggacgaaacagtcctgagtcgcagcggc
atggacgacggtcaggccatctggatgaaggatccactccagtcgcatttcttcaacacc
ctgcaggcaggcgagctgctgtacgagcggatgaagcaggtgttgcaggagcccgcgcct
gcacaggcggtgctgacctgctttcaccgtgtcctgctgctgggatttcgcgggcgttat
caggatccggtggccccggagcgcgaccagcttatttcgacgctcaacgggctggtcgcg
ccatttggcgtactgccggaaacggcggtactgaacgtgccgttatccacccgtcagcac
cctttgctgcattcgccgtttttctggctggtaacgctgacgctgctactggccggtgtc
tggtgggggctgcaccactggctgaacgtgctggtggatgaattgctgccgcaaagcctg
cggtaa

DBGET integrated database retrieval system