KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_3232Help
Entry
EcE24377A_3232    CDS       T00590                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system T protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
ecw00260  Glycine, serine and threonine metabolism
ecw00630  Glyoxylate and dicarboxylate metabolism
ecw00670  One carbon pool by folate
ecw01100  Metabolic pathways
ecw01110  Biosynthesis of secondary metabolites
ecw01130  Biosynthesis of antibiotics
ecw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ecw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    EcE24377A_3232 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EcE24377A_3232 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    EcE24377A_3232 (gcvT)
Enzymes [BR:ecw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     EcE24377A_3232 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C POPLD
Motif
Other DBs
NCBI-ProteinID: ABV17828
UniProt: A7ZR14
Structure
PDB: 

Position
complement(3252914..3254008)
Genome map
AA seq 364 aa AA seqDB search
MAQQTPLYEQHTLCGARMVDFHGWMMPLHYGSQIDEHHAVRTDAGMFDVSHMTIVDLRGS
RTREFLRYLLANDVAKLTKSGKALYSGMLNASGGVIDDLIVYYFTEDFFRLVVNSATREK
DLSWITQHAEPFGIEITVRDDLSMIAVQGPNAQAKAATLFNDAQRQAVEGMKPFFGVQAG
DLFIATTGYTGEAGYEIALPNEKAADFWRALVEAGVKPCGLGARDTLRLEAGMNLYGQEM
DETISPLAANMGWTIAWEPADRDFIGREALEVQREHGTEKLVGLVMTEKGVLRNELPVRF
TDAQGNQHEGIITSGTFSPTLGYSIALARVPEGIGETAIVQIRNREMPVKVTKPVFVRNG
KAVA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcacaacagactcctttgtacgaacaacacacgctttgcggcgctcgcatggtggat
ttccacggctggatgatgccgctgcattacggttcgcaaatcgacgaacatcatgcggta
cgtaccgatgccggaatgtttgatgtgtcacatatgaccatcgtcgatctccgcggcagc
cgcacccgggagtttctgcgttatctgctggcgaacgatgtggcgaagctcaccaaaagc
ggcaaagccctttactcggggatgttgaatgcctctggcggtgtgatagatgacctcatc
gtctactactttactgaagatttcttccgcctcgttgttaactccgccacccgcgaaaaa
gacctttcctggattacccaacacgctgaacctttcggcatcgaaattaccgttcgtgat
gacctttccatgattgccgtgcaagggccgaatgcgcaggcaaaagctgccacactgttt
aatgacgcccagcgtcaggcggtggaagggatgaaaccgttctttggcgtgcaggcgggc
gatctgtttattgccaccactggttataccggtgaagcgggctatgaaattgcgctgccc
aatgaaaaagcggccgatttctggcgtgcgctggtggaagcgggtgttaagccatgtggc
ttgggcgcgcgtgacacgctgcgtctggaagcgggcatgaatctttatggtcaggagatg
gacgaaactatttctcctttagccgccaacatgggctggactatcgcctgggaaccggca
gatcgtgactttatcggtcgtgaagccctggaagtgcagcgtgagcatggtacagaaaaa
ctggttggtctggtgatgaccgaaaaaggcgtgctgcgtaatgaactgccggtacgcttt
accgatgcgcagggcaaccagcatgaaggcattatcaccagcggtactttctccccgacg
ctgggttacagcattgcgctggcgcgcgtgccggaaggtattggcgaaacggcgattgtg
caaattcgcaaccgtgaaatgccggttaaagtgacaaaacctgtttttgtgcgtaacggc
aaagccgtcgcgtga

DBGET integrated database retrieval system