KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_3382Help
Entry
EcE24377A_3382    CDS       T00590                                 

Gene name
rafD
Definition
(GenBank) raffinose invertase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
ecw00052  Galactose metabolism
ecw00500  Starch and sucrose metabolism
ecw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecw00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    EcE24377A_3382 (rafD)
   00500 Starch and sucrose metabolism
    EcE24377A_3382 (rafD)
Enzymes [BR:ecw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     EcE24377A_3382 (rafD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: ABV16761
UniProt: A7ZRF2
Position
3403525..3404955
Genome map
AA seq 476 aa AA seqDB search
MKQRLALAQSALEKLCARRGNAWYPIFHLAPPAGWMNDPNGLIYFNGRYHAFFQHHPASA
YQGPMHWGHATSTDMLHWQHEPVALAPGDKYDRDGCFSGSAVDDDGVLSLIYTGHICLDD
RGNDSIIREVQCLATSHDGIHFEKQGCVLTPPEGIMHFRDPKVWHEDGSWWMVIGARDAS
DNGQVLLYRGTSLRDWHLEHVLAHSAAGKSYMWECPDFFRCGNFHWLMFSPQGMPPSGYR
FRNLFQSGVLAGSWKPGSVFALKGRFEELDYGHDFYAPQSMLAEDGRRIIMAWMNMWDSP
VPTRSEAWAGCLTLPREVFERDGRLCQRPVREVESLRRKCQPLSPVRLQGLQLLTENVQA
AELLVTWHTVDSHAEHYGVRLGDGLRLYVDNQAGRLVLWRYYPEEGLDGYRSVELPDTEY
LTLRIFLDRSSVEVFVNDGEATLSSRIYPQADSRQLSLYAAHGDAILTDGTLWMLT
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcgtcttgctttggcacagtctgcccttgaaaaactttgcgcacgtcgtggt
aatgcctggtacccgatttttcatctggctccacctgccggctggatgaatgatccaaat
ggccttatttacttcaatgggcgttaccatgcgttcttccagcatcatcctgcaagcgca
tatcaggggccaatgcactgggggcatgccaccagtaccgacatgttgcactggcaacac
gaacctgtcgcgctggcacccggagataaatatgatcgtgatggctgtttttcagggagt
gccgtggatgatgatggcgtgctatcacttatttatactggtcatatttgtctcgatgat
cgtggtaatgacagcattatccgtgaagtacagtgtctggctaccagtcatgatggtatt
cactttgagaagcagggctgtgtgctgacacctccggaaggtataatgcatttccgtgat
cccaaagtctggcacgaagacggctcctggtggatggtcattggtgcccgggacgcttct
gacaatgggcaagttctgttgtatcgcgggacatctttgcgggactggcatctggagcat
gttcttgctcattccgcagccggaaaaagttatatgtgggaatgccccgatttcttcagg
tgtggtaattttcactggctgatgttctcaccacaggggatgcccccttccggttatcgg
ttccgtaacctttttcagagcggtgtgttggcagggagctggaagcctggttctgtcttt
gcgctgaaagggagatttgaagagctggattatggtcatgacttttatgctccacagtcc
atgctggctgaggacggcaggcgtatcattatggcatggatgaatatgtgggattcaccc
gtgcccacccgcagtgaagcctgggcaggatgtctgacgctgcccagagaggtttttgag
cgcgatggccggctgtgccagcgacctgtgcgtgaagtcgaatctctgcgcagaaaatgc
cagccattatcccctgtaaggttacagggtttgcaattactgaccgaaaatgtacaggcc
gcagaattattggtgacgtggcatacggttgacagtcatgcggagcactatggcgtccgc
cttggagacggtctgcgactttatgtggataatcaggccgggcgactggtactgtggcgc
tattaccctgaggaagggctggatggttaccgcagtgttgaacttcctgatacagaatat
ctgactcttcgtattttcttggatcgttcatctgttgaagtgtttgttaacgatggtgag
gcaaccttatcaagtcgtatttatccgcaagcggactcgagacaattatcgttatatgcc
gctcatggcgatgcgatattaactgatggcactttatggatgctgacctga

DBGET integrated database retrieval system