KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_4967Help
Entry
EcE24377A_4967    CDS       T00590                                 

Gene name
holD
Definition
(GenBank) DNA polymerase III, psi subunit
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
ecw00230  Purine metabolism
ecw00240  Pyrimidine metabolism
ecw01100  Metabolic pathways
ecw03030  DNA replication
ecw03430  Mismatch repair
ecw03440  Homologous recombination
Module
ecw_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ecw00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    EcE24377A_4967 (holD)
   00240 Pyrimidine metabolism
    EcE24377A_4967 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    EcE24377A_4967 (holD)
   03430 Mismatch repair
    EcE24377A_4967 (holD)
   03440 Homologous recombination
    EcE24377A_4967 (holD)
Enzymes [BR:ecw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     EcE24377A_4967 (holD)
DNA replication proteins [BR:ecw03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     EcE24377A_4967 (holD)
DNA repair and recombination proteins [BR:ecw03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     EcE24377A_4967 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi CSTF_C
Motif
Other DBs
NCBI-ProteinID: ABV19417
UniProt: A7ZVR1
Structure
PDB: 

Position
4947148..4947561
Genome map
AA seq 137 aa AA seqDB search
MTSRRDWQLQQLGITQWSLRRPGALQGEIAIAIPAHVRLVMVANDLPALTDPLVSDVLRA
LTVSPDQVLQLTPEKIAMLPQGSRCNSWRLGTDEPLSLEGAQVASPALTDLRANPTARAA
LWQQICTYEHDFFPRND
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagttacagcaactgggcattacccagtggtcgctgcgt
cgccctggcgcgttgcagggggagattgccattgcgatcccggcacacgtccgtctggtg
atggtggcaaacgatcttcccgccctgactgatcctttagtgagcgatgttctgcgcgca
ttaaccgtcagccccgaccaggtgctgcaactgacgccagaaaaaatcgcgatgctgccg
caaggcagtcgctgcaacagctggcggttgggtactgacgaaccgctatcactggaaggc
gctcaggtggcatcaccggcgctcaccgatttacgggcaaacccaacggcacgcgccgcg
ttatggcaacaaatttgcacatatgaacacgatttcttccctcgaaacgactga

DBGET integrated database retrieval system