KEGG   Escherichia coli O9 HS (commensal): EcHS_A0226
Entry
EcHS_A0226        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EcHS_A0226
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecx02044]
    EcHS_A0226
Secretion system [BR:ecx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EcHS_A0226
SSDB
Motif
Pfam: IcmF-related IcmF-related_N IcmF_C AAA_16 HAD AAA_22
Other DBs
NCBI-ProteinID: ABV04617
Position
complement(241171..244695)
AA seq 1174 aa
MFRLPTPRLLSGLKSALRPAMPRFKVSAFWLLILAWIFLLVWIWWKGPTWTLYEEQWLKP
LANRWLATAAWGIIALMWLTVRVMKRLQQLEKMQKQQREEAVDPLSVELNAQQRYLDRWL
LRLQRHLDNRRFLWQLPWYMVIGPAGSGKTTLLREGFPSDIIYAPEGARGAEQRLYLTPH
VGKQAVIFDIDGTLCAPADADILHRRLWEHALGWLKEKRARQPLNGIILTLDLPDLLTAD
KRRREHLLQALRSRLQDIRQHLHCQLPVYVVLTRLDLLQGFAALFQSLNRQDRDAILGVT
FTRRAHENDDWRTELNAFWQTWVDRMNLALPDLMVAQTHTRASLFSFSRQMQGSREPLVS
LLEGLLDGENMNVMLRGVYLTSSLQRGQMDDIFTQSAARQYRLGNNPLASWPLVDTAPYF
TRSLFPQALLAEPNLATESRAWLIRSRRRLTVFSATGGVAALLLITGWHHYYNGNYQSGI
TVLKQAKAFMDVPPPQGEDDFGNLQLPLLNPVRDATLAYGDWGDRSRLADMGLYQGRRIG
PYVEQTYLQLLEQRYLPSLFNGLVKALNAAPPESEEKLAVLRVMRMLEDKSGRNNQVVKQ
YMAKRWSEKFHGQRDIQAQLMSHLDYALAHTDWHAERQAGDGDAISRWTPYDKPVVSAQK
ELSKLPVYQRVYQSLKTRALGVLPADLNLRDQVGPTFDQVFTSADDNKLVVPQFLTRYGL
QSYFVKQRDELVELTAMDSWVLNLTRSVKYSDADRAEIQRQLTEQYISDYTATWRAGMDN
LNIRNFESIGQLTGALEQVISGDQPLQRALTVLRDNTQPGVFSEKLSAKEREEALAEPDY
QLLTRLGHEFAPENSTLAVQKDKESTMQAVYQQLTELHRYLLAIQNAPVPGKSALKAVQL
RLDQNSSDPIFATRQMAKTLPAPLNRWVGRLTDQAWHVVMVEAVHYMEVDWRDSVVKPFN
EQLANNYPFNPRSAQDASLDAFERFFKPDGILDTFYQQNLKLFIDNDLSLEDGDNNVIIR
EDIIAQLETAQKIRDIFFSKQNGLGTSFAVETVSLSGNKRRSVLNLDGQLVDYSQGRNYT
AHLVWPNNMREGNESKLTLIGTSGNAPRSISFSGPWAQFRLFGAGQLTGVQDGNFTVRFS
VDGGAMTYRVHTDTEDNPFSGGLFSQFGLSDTLY
NT seq 3525 nt   +upstreamnt  +downstreamnt
gtgttcagattaccaacaccccgactactcagcggactcaaatcagccctgcgaccggcg
atgccccggtttaaagtctctgctttctggctgctgatactggcgtggatttttctgctg
gtgtggatctggtggaaaggcccgacgtggacgctgtatgaagaacagtggctcaaacca
ctggcgaaccgctggctggcaacggcggcgtgggggattattgccctgatgtggcttacc
gtccgggtgatgaagcgcctgcaacagcttgaaaaaatgcaaaagcaacagcgcgaggaa
gccgttgatccgctcagcgtggaactgaacgcccagcagcgttatcttgaccgctggctg
ctgcgcctgcaacgccatctcgacaaccgccgtttcctgtggcagttgccgtggtatatg
gtcatcggcccggcgggcagtggcaaaacgacactgctgcgcgaggggtttccgtccgac
attatttatgccccggagggcgcacgcggcgcagaacaacgcctgtacctcacgccccat
gtcggtaaacaggcggtgatctttgatatcgacggcacactctgcgctcccgctgatgcg
gatatcctgcatcgccgtctgtgggaacatgccctcggctggctgaaagaaaagcgcgcg
cgccagccgctgaatgggattattctgacactcgatttacccgatctgcttaccgcagac
aaacgccgccgcgagcatctgttacaggcgctgcgcagccgcttgcaggatatacgccag
catcttcactgccagttaccggtttacgtggtacttacccggcttgatttattgcagggt
tttgccgccctgtttcagtccctgaacagacaggatcgcgatgcgattctgggcgtcacg
ttcacccgccgtgcccatgaaaatgatgactggcgaacagagttgaatgctttctggcag
acatgggtggatcgaatgaatctggcgttgccggatctgatggtcgctcagactcacacc
cgcgcgtctttattcagtttttcccgccagatgcagggaagccgtgaaccgctggtgtca
ctgcttgagggtctgcttgatggcgaaaatatgaacgtgatgctgcgtggtgtctatctc
acctcttcgcttcagcgtggacagatggatgatatattcacccagtctgccgcccgccag
taccggctgggcaataacccactggcgtcctggcccctggtggacaccgcgccttatttc
acccgcagcctgttcccgcaggcattactcgcagagcctaatctggcaacagagagccgc
gcctggctgatacgttcccgtcgccgcctgacggttttctctgccacaggcggcgtggca
gcactgctgctcatcaccggctggcatcactattacaacggtaactatcagtctggcatc
accgtgcttaagcaggccaaagcctttatggacgtgccgcctccgcagggggaagatgac
tttggcaacctgcaactgccgctcctgaacccggtacgcgatgccacactggcctatggc
gactggggcgaccgcagccgtctggccgatatgggactgtaccagggacgacgtatcggg
ccttatgtggaacagacctatctgcaactgctggagcaacgttacctgccctcgctgttt
aacgggctggtcaaagcgctgaacgccgcgccgccggagagtgaagaaaaactcgcggtg
ctgcgcgtgatgcgaatgctggaggacaaaagcggacgtaacaatcaggtggtgaagcag
tatatggcaaaacgctggagcgaaaagttccacggtcagcgcgatatccaggcacaactg
atgtcccatcttgactacgcgctggctcatactgactggcacgcagagcgtcaggcgggc
gacggtgacgccatcagccgctggacgccatatgacaagcccgtggtatcagcacagaaa
gaactgagcaaactgcctgtctaccagcgggtttaccagagcctgaaaacgcgggcgctg
ggcgttcttcctgccgacctcaatctgcgtgaccaggtagggccaacctttgaccaggtg
tttacatctgccgatgacaacaaactggttgttccacagtttcttacccgttacggcctg
caaagctattttgtaaaacagcgcgatgaactggttgaactgacggcgatggattcctgg
gtacttaaccttacccgcagcgtgaaatacagtgacgccgaccgcgcggaaatccagcgc
cagttgaccgagcagtatatcagcgactacaccgccacctggcgggccgggatggacaat
ctgaatatccgcaattttgagtccatcggacaactgaccggggcgctggagcaggttatc
agcggcgaccagcctttgcagcgggcgctgaccgtgctgcgtgacaacacacagccaggc
gtcttttctgaaaaactctctgccaaagaacgggaggaagccctggcagagccggattac
cagttactcacccgcctcgggcatgaattcgccccggaaaacagtaccctggcagtacag
aaagacaaagaaagcacgatgcaggccgtgtatcagcaactcaccgagttgcaccgctac
ctgctggcaatccagaacgcgcctgtaccagggaaatcggcgctgaaagccgtgcagtta
cggcttgatcagaacagcagcgatccgatattcgccacccgccagatggcaaaaacgctg
cctgctccgctcaaccgctgggttggcagactgactgaccaggcctggcatgtggtgatg
gtggaggctgttcattatatggaagtggactggcgcgacagcgtggtgaaaccgtttaac
gagcaactggcaaataactatccgtttaatccgcgttctgcacaggatgcctcactggat
gccttcgaacgcttctttaaaccggatggcatactggataccttctaccagcagaacctg
aagctgtttatcgataatgacctgagtctggaggatggcgataacaacgtcattattcgc
gaagatattattgcgcaactggaaactgcgcagaaaatccgtgacatcttcttcagcaaa
cagaacggtctgggaacatcctttgccgtggaaacggtatcgctttcaggcaataaacgc
cgcagtgtactgaaccttgacggtcagttagtcgattacagccagggccgtaactatacc
gcccatctggtctggcctaacaacatgcgcgaaggcaacgaaagtaagctgacgctcatc
ggcaccagcggcaacgcgccgcgcagtatcagcttcagcgggccgtgggcgcagttccgc
ctgttcggggccggacaactgaccggagtacaggatggcaactttaccgtgcgctttagc
gtggacggtggcgcgatgacctaccgtgtgcataccgacacggaagataacccgttcagc
ggtgggttgttcagccagtttggtctgtcagacacactgtactga

DBGET integrated database retrieval system