KEGG   Escherichia coli O9 HS (commensal): EcHS_A0229
Entry
EcHS_A0229        CDS       T00591                                 

Gene name
clpV
Definition
(GenBank) type VI secretion ATPase, ClpV1 family
  KO
K11907  type VI secretion system protein VasG
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EcHS_A0229 (clpV)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecx02044]
    EcHS_A0229 (clpV)
Secretion system [BR:ecx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EcHS_A0229 (clpV)
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 AAA_16 ClpB_D2-small AAA_22 AAA_7 NACHT RsgA_GTPase AAA_18 AAA_24 Sigma54_activat Rad17 AAA_6 ABC_tran_CTD
Other DBs
NCBI-ProteinID: ABV04620
Position
complement(246871..249642)
AA seq 923 aa
MIQIDLPTLVKRLNLFSRQALEMAASECMSQQAAEITVSHVLIQMLAMPRSDLRVITRQG
DIGMEELRQALTVENYTTARSADSYPAFSPMLVEWLKEGWLLASAEMQHSELRGGVLLLA
LLHSPLRYIPPAAARLLTGINRDRLQQDFVQWTQESAESVVPDADGKGAGTLTDAADTLL
ARYAKNMTADARNGRLDPVLCRDHEIDLMIDILCRRRKNNPVVVGEAGVGKSALIEGLAL
RIVAGHVPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKGLMAEVISSPVPVILFIDEAH
TLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSRRFQLVKVSEP
NAAEATIILRGLSAVYEQSHGVLIDDDALQAAATLSERYLSGRQLPDKAIDVLDTACARV
AINLSSPPKQISALTTLSHQQEAEIRQLERELRIGLRTDTSRMTEVLVQYDETLTALDEL
EAAWHQQQTLVREIIALRQQLLGVAEDDAAPLPDADTVEDTQPESESESEQDNTGAEPAD
EAGSEQPKETAETVSPVQRLAHLTAELDALHNDRLLVSPHVDKKQIAAVIAEWTGVPLNR
LSQNEMSVITDLPKWLGDTIKGQDLAIASLHKHLLTARADLRRPGRPLGAFLLAGPSGVG
KTETVLQLAELLYGGRQYLTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGVLTEAIRQKP
YSVVLLDEVEKAHPDVLNLFYQAFDKGEMADGEGRLIDCKNIVFFLTSNLGYQVIVEHAD
DPETMQEVLYPVLADFFKPALLARMEVVPYLPLSKETLATIIAGKLARLDNVLRSRFGAE
VIIEPEVTDEIMSRVTRAENGARMLESVIDGNMLPPLSLLLLQKMAANTAVARIRLSAVD
GAFTADVEDAQNDESVTKDETVL
NT seq 2772 nt   +upstreamnt  +downstreamnt
atgatccagattgatcttcccacgctggtaaaacggcttaacctgttctcccgccaggcg
ctggagatggccgcctctgaatgtatgagccagcaggcagcggaaattaccgtcagccat
gtgcttattcagatgctcgccatgccacgcagtgacctgcgggttattacccgccagggc
gatattggcatggaagagttgcgccaggcgctgacggtggagaactacacaactgcccgt
tctgcggacagctacccggcattttccccgatgctggttgagtggctgaaagagggctgg
ctgctggcgtcggctgagatgcagcacagcgaattgcgtggcggcgtgttgctgctggcc
ctgctgcattcgccgctgcgttatataccgcctgctgccgcccggctgttgaccggcatt
aaccgtgaccgtctgcaacaggactttgtgcaatggacacaggagtcggcggaatcagtc
gtgccggatgcagacggtaaaggcgcaggcacactgacggacgctgctgacaccctgctt
gcccgctacgccaaaaacatgaccgcagacgcccgtaacggcaggcttgacccggtactg
tgccgcgaccacgaaatcgacctgatgatcgacattctctgccgccgccgcaagaacaac
ccggtggtggtgggcgaagcaggcgtgggtaaaagcgccttaatcgaagggctggcgctg
cgcatcgtggcaggccatgtgccggacaagctgaaaaacaccgatatcatgacccttgac
ttgggcgcattgcaggccggagcgtcggtgaagggtgaattcgaaaaacgtttcaaaggg
ctgatggcggaggtcatttcctccccggtgccggtcattctgtttatcgacgaagcacat
accctgattggcgcgggcaaccagcagggcgggctggatatctccaacctgctcaaaccg
gcgctggcgcgcggcgagctgaaaaccatcgccgccaccacctggagcgagtacaaaaaa
tacttcgaaaaagatgccgccctgtcgcgccgcttccagttggtgaaggtcagcgaaccc
aacgctgccgaagccaccattattctgcgcggtctgtcggcggtctatgaacagtctcac
ggcgtgctgattgatgatgacgccttgcaggccgctgcgacattaagcgagcgttatctc
tccgggcgtcagttaccggacaaagcgattgatgtgctggataccgcctgcgcccgtgtg
gccatcaacctgtcgtcgccgccgaagcaaatctcggcgctgaccactctgagccaccag
caggaggcggaaattcgccagcttgagcgcgagcttcgcatcggactgcgtaccgacaca
tcacggatgaccgaggtgctggtgcagtatgatgaaacgctgacggcgctggatgaactg
gaagcggcctggcaccagcagcagacgctggtccgggagattattgcgctgcgccagcag
ttactgggcgtggcagaggacgatgcggcgccgttgccggacgcagataccgtggaggat
acgcagccagagtcagagtcagagtcagagcaggataataccggtgccgaaccggctgat
gaagctggcagcgaacagccgaaagagaccgctgaaacagtttccccggtacaacgtctg
gcacatctcactgccgaactggacgccctgcataacgaccggttgctggtttccccgcac
gtcgataaaaaacagattgcggcggtgattgccgaatggaccggcgtgccgcttaaccgc
ctgtcgcagaatgaaatgtcggtcatcaccgacctgccaaaatggctcggcgacaccatc
aaaggccaggacctggcgattgccagcctgcacaaacacctgctgaccgcacgcgccgac
ctgcgccgtccgggacgcccgctgggcgcgttcctgctggctggccccagcggcgtgggt
aaaactgaaaccgtcctgcaactggcagagctgctctacggcggtcgccagtacctgacc
accatcaatatgtccgagttccaggagaaacataccgtctcgcgactgattggttcgcct
ccgggctacgttggctacggtgaaggcggcgtactgaccgaagcgattcgccagaaaccc
tactcggtagtactgctcgatgaagtggaaaaagcgcacccggatgtgctcaacctgttc
taccaggcgttcgataagggcgaaatggcagacggtgaaggccgcctgattgactgcaaa
aatatcgtcttcttcctgacgtccaacctcggctaccaggtaatagtcgagcatgccgat
gacccggaaaccatgcaggaagtactgtatccggtgctggccgacttcttcaaacctgcc
ctgctggcgcgtatggaagtggtgccgtacctgccgctgtcgaaagagacgctcgccacc
atcattgccgggaaactggcccgcctggataacgtgctgcgcagccgctttggcgcggag
gtgattatagaaccggaagtgacggacgaaatcatgagccgcgtcacccgcgcggaaaac
ggcgcgaggatgctggaatcggtcatcgacggcaatatgctgccgccgctctccctgctg
ctgttgcagaaaatggcggcgaatacggcggttgcccggattcggttgtcggcagtggac
ggcgcatttacggcagacgtggaagatgctcagaacgacgagtccgtcacaaaggatgaa
acggttttatga

DBGET integrated database retrieval system