KEGG   Escherichia coli O9 HS (commensal): EcHS_A0230
Entry
EcHS_A0230        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EcHS_A0230
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecx02044]
    EcHS_A0230
Secretion system [BR:ecx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EcHS_A0230
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: ABV04621
Position
complement(249651..250412)
AA seq 253 aa
MDEGSLSLPPFTGYDEKSQRDYHLALRGNSLNPMIDAATPLLGMVMRLSTMNSQTMPEHL
FAQVVTDVQAVEQLLQEQGYEPGVIISFRYILCTFIDEAALGNGWSNKNEWIKQSLLVHF
HNEAWGGEKVFILLERLIREPKRYQDLLEFLWLCFSLGFRGRYKVAAQDQGEFEQIYRRL
YHVLHKLRGDAPFPLLHQDKKTQGGRYQLISRLTIKHIFCGGVVVLALFYLFYLLRLDSQ
TQDILHQLNKLLR
NT seq 762 nt   +upstreamnt  +downstreamnt
atggatgaggggtcactgtctctgccaccatttaccggatacgacgaaaaaagccagcgc
gactatcatctcgcgcttcgtggcaacagcctgaatccgatgatcgacgcggccacgccg
ctactcggtatggtaatgcgcctttcaaccatgaacagccagacgatgccggagcatctt
tttgctcaggtggtgacggatgttcaggccgtggagcaactgcttcaggagcagggctac
gaaccgggcgtgattatctcgtttcgctacatcctctgcacgtttattgatgaagcggcg
ctcggtaacggctggtcgaacaagaacgagtggatcaagcagtcattgctggtccatttc
cacaacgaagcctggggtggagagaaagttttcatcctgctggagcgcctgatccgtgaa
cccaaacgttaccaggatctgctggaatttctctggctctgtttttctctgggatttcgc
gggcgctacaaagtggcagcacaggatcagggggaatttgagcagatctaccgccgcctg
taccacgtcctgcataaactacgcggcgatgcccctttcccgctgttacaccaggacaaa
aaaacccagggcgggcgttatcagctcatcagtcgcctgaccattaaacatattttttgt
ggtggcgttgtcgtgctggcgttgttttacctgttctatctgttgcggctggacagccag
acgcaggacatcctgcaccagctaaacaaattacttcgataa

DBGET integrated database retrieval system