KEGG   Escherichia coli O9 HS (commensal): EcHS_A0232
Entry
EcHS_A0232        CDS       T00591                                 

Definition
(GenBank) type VI secretion lipoprotein, VC_A0113 family
  KO
K11906  type VI secretion system protein VasD
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EcHS_A0232
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecx02044]
    EcHS_A0232
Secretion system [BR:ecx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EcHS_A0232
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: ABV04623
Position
complement(251751..252275)
AA seq 174 aa
MNRKAFLACVLMCVILTGCETAKKISEVIKNPDIQVGSLKEQPSEITVTLLTEPDTNTNA
EGESAAVDVQLVYLTDDSKLLAADYDQIASTPLPDVLGKNYIDHQDFNLLPDTIKTLPPV
KLDEKTQFIGVVAYFSDDQATEWKQIETVEGTGHHYRLLVHVRQSSIEMKKEDE
NT seq 525 nt   +upstreamnt  +downstreamnt
atgaacaggaaggcgtttctggcctgcgtgctgatgtgcgtcatattaaccggctgcgaa
acggcgaaaaaaatcagtgaggtgatcaaaaacccggatatccaggtcgggagcctgaag
gagcaaccttcggaaataaccgtcaccctgctgaccgaaccggacaccaataccaatgcg
gaaggtgaatcagccgccgtggatgtgcaactggtgtacctgactgacgactcaaaattg
ctggcagccgactatgaccagatagccagtacgccgctaccggatgtgctgggtaaaaac
tatatcgaccaccaggatttcaacctgttgccggacaccatcaaaaccctgccgccggta
aagctggatgagaaaacgcagtttattggtgtcgtggcctatttctccgatgaccaggcc
actgaatggaaacaaatcgagacggtggaaggaaccggccaccattaccgcctgctggtg
catgtacgtcaaagcagcatcgaaatgaaaaaagaggatgaataa

DBGET integrated database retrieval system