KEGG   Escherichia coli O9 HS (commensal): EcHS_A0235
Entry
EcHS_A0235        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecx02044]
    EcHS_A0235
Secretion system [BR:ecx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EcHS_A0235
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ABV04626
Position
complement(254623..256473)
AA seq 616 aa
MEFEERYFREELDYLRQLSKLLATEKPHLARFLAEKDADPDIERLLEGVAFLTGNLRQKI
EDEFPELTHGLIKMLWPNYLRPVPAMTLIEYTPDMDKSSVPVLIPRNEQFTTNAGEIRVD
EVLPSDAKKEEPPPCTFTLCRDIWLLPVRLEQIENRSTTRNGVINITFSVAPGTDFRTLD
LNKLRFWLGNDDNYTRDQLYLWFCEYLQGADLTVGEQHIRLPEFMLKAVGFEPQDAMLPW
PKNVHSGYRILQEYFCYPDAFLFFDLCGCPALPDGLQAEFFTLQLRFSRPLPVDIRLRRD
SLRLYCAPAINLFIHHAEAITLDNRRADYPLVPSRHYPQHYDVFSVNSVVSQVQDMFRKK
DLGRPVSTQAARQWPAFESFSHQMEYSRKREVVYWHHRTKTSLFHRGFDHTLAFIHADGS
YPSDESLLSNEVVSVSLTCTNRELPSQIRSGDITGTTGKNAAVASFRNITRPTQPLWPVI
DGSLHWSLLSAMNLNYLSLLDTDALKQVIANFDRHAIHHPQTARLSQQKLDAIERLETRP
VDRLFTGIPVRGLASTLYLHPEPFVCEGEMYLLGTVLSHFLSLYASVNSFHMLTVVNTES
QETWKWTERIGQHPLI
NT seq 1851 nt   +upstreamnt  +downstreamnt
atggaatttgaagaacgctatttccgggaagaactcgattacctgcgccagcttagcaag
ctgctggcaacggaaaaaccccatctggcccgcttcctggccgaaaaagatgcggatccg
gatattgaacgcctgctggaaggggtggcttttcttaccggcaatctccgccagaaaatt
gaggatgaattcccagaactgacgcacgggcttattaagatgctatggcctaattacctg
cgtccggttccggcaatgacccttattgaatatacgccggatatggataagtcttctgta
ccggtgttaatcccccgtaatgagcagtttacaaccaacgccggggaaatcagagttgat
gaagtgctgccctctgatgctaaaaaggaggagccgcctccctgtaccttcactctctgc
cgggatatctggctgctgcccgttcgcctggagcagattgaaaaccgcagtacgacccgt
aatggtgttatcaacatcaccttttcggtcgcaccgggaacggacttccgcacgctggat
ctgaacaaacttcgcttctggctcggcaatgacgacaactatacccgtgaccagctttat
ttatggttctgcgaatacttgcagggtgccgacctgactgtgggtgaacagcatattcgc
ctgcctgagtttatgctaaaagctgtcggttttgagccgcaggatgccatgctgccctgg
ccgaaaaacgtccacagcggctaccggatccttcaggagtatttctgttaccccgatgcg
tttctcttttttgatctttgtggttgtccggctttgcctgacggattgcaggcggaattc
tttaccctgcaactgcgtttttcgcgccctttgcccgtggacatccggctgcgccgcgat
tccctgcgcctgtattgcgcacctgccattaatttatttatccaccatgcagaagccatc
acgctggacaaccggcgggcagactatccgctggttcccagccgccattacccacaacat
tacgatgtattttccgttaacagtgtggtgagccaggtccaggatatgttcaggaaaaaa
gatctggggcgtcctgtttcgacgcaggccgcgcgccagtggccagcctttgaaagtttc
agccatcagatggaatacagccggaagcgggaagtggtgtactggcatcaccggaccaaa
acatccctgttccatcgcggctttgatcatacccttgcctttatacatgctgatggcagt
tatccgtcagacgaatctctgctcagtaatgaagtggtttcggtatcgctgacctgtacc
aaccgtgagcttccgtcacaaattcgttccggcgatatcaccggcacaaccggtaaaaat
gcagctgttgcttcatttcgcaacattacccgcccgacgcaaccactctggccggtcatt
gatggcagcctgcactggtccctactctccgccatgaacctgaattatctgtcattactg
gatacggacgcgctgaagcaggtcatcgccaactttgatcgccacgcaatccatcatccg
cagacggcacggctgtcacaacaaaagctggatgccattgagcgtctggagacccgcccc
gttgatcgcctgtttacgggtattcccgtccggggactggcctccacgctgtatctgcac
ccggagccgtttgtctgtgaaggggaaatgtatctgctcggtacggtgctttcgcatttt
ctgtcgctgtacgccagcgttaactcattccacatgctgaccgttgtgaacacagaaagc
caggagacatggaaatggacggaaagaatcgggcagcatcctcttatctga

DBGET integrated database retrieval system