KEGG   Escherichia coli O9 HS (commensal): EcHS_A0237
Entry
EcHS_A0237        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecx02044]
    EcHS_A0237
Secretion system [BR:ecx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EcHS_A0237
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: ABV04628
Position
complement(256897..258372)
AA seq 491 aa
MSLQEEELVSSHAGQPEQASSLLDQIMAQTRIQPGSEGYDVARQGVTAFIASILQSTASA
EPVNKLAVDSMIADIDERISRQMDVIIHAPAFQQVESFWRSLKTMVDRVDFRENIKVNVL
HVTKQELLEDFEFAPEIIQSGFYKHVYSSGFGQFGGEPIAAVLGAYEFKNTAPDMKLLQY
VSAVGAMAHAPFLSSVSPEFMGLNSWTELPNIKDLYAIFEGPAYTKWRALRDSEDSRYLG
LTAPRFLLRQPYSPTDNPVKNFNYYEDVSQNHEDYLWGNTAWMLACNIADSFAKYRWCPN
IIGPQSGGAVKDLPVHLFETMGQIQAKIPTEVLVTDRREFELAEEGFITLTMRKDSDNAA
FFSANSVQKPKHFPGKDAETNYKLGTQLPYLFIINRLAHYIKVLQREQLGSWKERSDLER
ELNTWIRQYVADQENPPADVRSRKPLRAAKVEVMDVEGEPGWYQVALSVRPHFKFMGANF
ELSLVGRLDRE
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgtctttacaggaagaggaactcgtttccagtcatgccgggcagcctgagcaggcatcg
tcgctgcttgatcaaatcatggcacagacccgtattcagcccggttcggaaggttatgac
gttgcccgccagggtgtgacagcctttattgccagcatcctgcaatccactgcatctgcc
gaaccggtcaataaactggccgtggacagcatgattgcagatattgatgaacgcatcagc
cgccagatggatgtcatcatccatgcgcctgcctttcagcaggtcgaatcgttctggcgc
tcactgaaaaccatggtggatcgcgttgatttccgtgaaaacatcaaggtcaacgtgctt
catgtcaccaagcaggaacttctggaagactttgagtttgcgccagaaattattcagtcc
ggattttataagcacgtttattcgtccggtttcggacagtttggcggtgaacccatcgct
gccgtgctgggcgcttatgagttcaaaaataccgcgcctgacatgaaactgctgcaatac
gtcagtgccgtgggcgcaatggcgcacgcaccgttcctgtcctccgtttccccggagttt
atggggctgaactcgtggaccgaactgcctaatatcaaagatctttatgccatctttgaa
ggtccggcctacaccaaatggcgcgccctgcgtgactcggaagattcgcgctatttaggg
cttacggcaccccgcttcctgcttcgccagccctattcaccaacagataaccctgttaag
aactttaactattacgaagatgtcagccagaaccacgaagattatctgtggggtaatacg
gcctggatgctggcatgcaatatcgcagacagttttgccaaataccgctggtgtccaaac
attatcggtccgcaaagcggcggcgcagtgaaagatctgccggtgcatctgttcgaaacg
atggggcagattcaggccaaaatcccaaccgaggtgctggtcaccgatcgccgcgaattt
gaactggctgaagagggttttatcacccttaccatgcgtaaagactctgataatgcagcc
tttttctctgcaaactcggtacaaaaaccgaagcactttccgggaaaagatgcagaaacc
aactataagctgggtacgcagcttccttatctcttcatcatcaatcggttagcgcactac
atcaaggtgttgcagcgtgaacaactggggtcatggaaagaaaggagcgacttagaaaga
gagcttaatacctggatccgtcagtatgttgccgaccaggaaaacccgcctgcagacgtg
cgcagccgcaaacctctgcgcgctgccaaagttgaggttatggatgtagaaggcgaaccc
ggctggtaccaggttgcgctaagcgtgaggcctcattttaaatttatgggggcaaatttt
gagctttccctggttggccggttagacagggagtaa

DBGET integrated database retrieval system