KEGG   Escherichia coli O9 HS (commensal): EcHS_A0238
Entry
EcHS_A0238        CDS       T00591                                 

Definition
(GenBank) hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: VipB
Other DBs
NCBI-ProteinID: ABV04629
Position
complement(258423..258647)
AA seq 74 aa
MTAHKNISGTYHLSVADILQVVYQVCFSPSVEINQDGVAALITTLDRRISDLLDEIIHFC
EFQQSASHWQRVLH
NT seq 225 nt   +upstreamnt  +downstreamnt
atgacggcacacaaaaatatctccgggacataccacctctctgttgcagacattctgcag
gtggtttaccaggtatgtttcagcccgtccgttgaaatcaaccaggatggtgtggctgcg
ctgattacaacactggatcgccgtatcagtgatctattggatgagattatccatttttgt
gagtttcagcagagcgcgtcgcactggcagcgcgtacttcactga

DBGET integrated database retrieval system