KEGG   Escherichia coli O9 HS (commensal): EcHS_A0242
Entry
EcHS_A0242        CDS       T00591                                 

Definition
(GenBank) hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Other DBs
NCBI-ProteinID: ABV04633
Position
260430..260567
AA seq 45 aa
MLFLYYAVERKVVSKGLRSREMAAAGNFGGSVPERKRNTVLSQPL
NT seq 138 nt   +upstreamnt  +downstreamnt
atgctgtttttgtattacgccgtagaaagaaaggttgtcagtaaggggttacgttcacgg
gagatggcggctgccggaaacttcggcggtagcgtgcctgaacgcaagcgtaacactgta
ctgtcacagccgctttaa

DBGET integrated database retrieval system