KEGG   Escherichia coli O9 HS (commensal): EcHS_A0243
Entry
EcHS_A0243        CDS       T00591                                 

Definition
(GenBank) type VI secretion system Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EcHS_A0243
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecx02044]
    EcHS_A0243
Secretion system [BR:ecx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EcHS_A0243
SSDB
Motif
Pfam: Phage_GPD Phage_base_V DUF1419
Other DBs
NCBI-ProteinID: ABV04634
Position
260607..262748
AA seq 713 aa
MSTGLRFTLEVDGLPPDAFAVVSFHLNQSLSSLFSLDLSLVSQQFLSLEFQQILDKMAYL
TIWQGDDVQRRVKGMVTWFELGENDKNQMLYSMKVCPPLWRTGLRQNFRIFQNEDIESIL
GTILQENGVTEWSPMFSEPHPSREFCVQYGETDYDFLCRMAAEEGIFFYEEHAQKSTDQS
LVLCDTVRYLPESFEIPWNPNTRTEVSTLCISQFRYSAQIRPSSVVTKDYTFKRPGWAGR
FDQEGQYQDYQRTQYEVYDYPGRFKGAHGQNFARWQMDGWRNNAEVARGTSRSPEIWPGR
RIVLTGHPQANLNREWQVVASDLHGEQPQAVPGRRGSGTTLDNHFAVIPADRTWRPQPLL
KPLVDGPQSAVVTGPAGEEIFCDEHGRVRVKFNWDRYNPSNQESSCWIRVAQAWAGTGFG
NLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRTPGSLPGTKTQMTIRSKTYKGSGFN
ELKFDDATGKEQVYIHAQKNMNTEVLNNRTTDVINNHAEKIGNNQAITVTNNQIQNIGVN
QIQTVGVNQVETVGSNQIIKVGSNQVEKVGIIRALTVGVAYQTTVGGIMNTSVALLQSSQ
VGLHKSLMVGMGYSVNVGNNVTFSVGKTMKENTGQTAVYSAGEHLELCCGKARLVLTKDG
SIFLNGTHIHLEGESDVNGDAPVINWNCGATQPVPDAPVPKDLPPGMPDMRQF
NT seq 2142 nt   +upstreamnt  +downstreamnt
atgtcaaccggattacgtttcacgctggaagtggacggcctgccaccggatgcttttgcg
gtggtctcctttcatctgaaccagtcactctcttcgcttttttccctcgatctctctctg
gtcagccagcagtttctctcccttgaattccagcagatcctcgacaaaatggcctacctg
acgatatggcagggcgatgacgtacagcgccgggtgaaaggtatggtgacctggtttgaa
ctgggggagaacgacaaaaaccagatgctgtacagcatgaaggtgtgcccaccgctgtgg
cgcacagggctgcgccagaacttccgtatcttccagaatgaggacatcgaaagcatcctc
ggcacgatattgcaggaaaacggggtgaccgagtggagcccgatgttcagcgagccacat
ccttcccgtgagttttgtgtccagtacggtgagactgattacgatttcctgtgccggatg
gcggcggaggaaggcatcttcttttatgaggagcacgcgcaaaaaagtaccgaccagagc
ctggtcctgtgcgataccgtgcgttatctgccggagtcctttgagatcccctggaatccg
aacacccgtaccgaggtgagcaccctctgcatcagccagtttcgctacagcgcacaaatc
cgcccttcttccgtggtgaccaaagactacacctttaaacgacccggctgggcagggcgt
tttgatcaggaaggccagtaccaggattaccagcgcacacagtatgaagtgtatgactac
cccggacgtttcaagggtgcccacgggcagaactttgcccgctggcagatggatggctgg
cgcaacaacgcagaagtggcgcgcggaacaagccgttcgccggagatatggccgggacgg
cgaattgtgctgacggggcatccgcaggcgaacctgaaccgggaatggcaggtggtggcg
agcgatcttcacggcgaacagccgcaggcggtaccgggacgcaggggttcaggcaccacg
ctggataaccactttgcggtaatcccggcagaccggacatggcggccacagccgttgctg
aaaccgctggtggacggcccgcagagcgccgtcgtgacgggaccggcaggcgaggaaatc
ttctgtgatgaacatggccgcgtgcgggtgaaatttaactgggaccgctataacccgtca
aaccaggaaagttcatgctggatccgtgtggcacaggcgtgggcaggcaccggctttggt
aacctggcgataccgcgtgtgggtcaggaggtcattgtggacttcctcaacggcgatccg
gaccagccgatcattatggggcgtacctaccaccaggaaaaccgcacccccggcagcctg
ccggggacgaagacgcagatgacgatccgctcgaaaacctataagggcagcgggtttaat
gaactgaagtttgacgatgcgacagggaaagaacaggtctacatccacgcgcagaagaac
atgaacaccgaggtgctgaataaccgcaccactgatgtgataaacaaccatgccgaaaaa
ataggtaacaaccaggcgatcaccgttaccaataaccagatccagaacattggcgttaat
cagatacagacggttggtgtcaaccaggtggaaacggtgggcagtaaccagattatcaaa
gtgggatcaaaccaggttgaaaaggtggggatcattcgtgcgctgacggtgggtgtggct
taccagacgacggtaggcggcattatgaatacctcggtggcgttgttgcagtcctcacag
gtagggctgcataaatcactgatggtgggaatgggctacagcgtcaatgtggggaataac
gtcaccttctcggtgggcaagacaatgaaggaaaacaccggacaaacagcagtttattct
gccggtgagcatcttgaactctgctgtggtaaggcaaggctggtgctgacgaaggacgga
agcatatttctcaatggtacgcacattcatctggaaggggagtcggatgtgaacggtgat
gcgccagtgattaactggaactgtggtgccacacaacctgtaccggatgcgcctgtgccg
aaagatttaccccccggaatgccggatatgcggcaattttga

DBGET integrated database retrieval system