KEGG   Escherichia coli O9 HS (commensal): EcHS_A0244
Entry
EcHS_A0244        CDS       T00591                                 

Gene name
rhsH
Definition
(GenBank) protein RhsH
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: RHS_repeat RHS Peptidase_M91
Other DBs
NCBI-ProteinID: ABV04635
Position
262824..267077
AA seq 1417 aa
MGGKPAARQGDMTRKGLDIVQGSAGVLIGAPTGVACSVCPGGITYANPVNPLLGAKVLPG
ETDLALPGPLPFILSRAYSSYRTRTPAPVGVFGPGWKAPFDIRLQIRDEGLILNDSGGRS
IHFEPLFPGEISYSRSESLWLARGGVAAQHSSQPLSALWQVLPEDVRLSPHVYLATNSLQ
GPWWILSWPERVPGADEVLPPEPPAYRVLTGVVDGFGRTLAFHRAAEGDVAGAVTGVTDG
AGRRFHLVLTTQAQRAEVFRKQRATSLSSPAGPRSASSSLVFPDTLPAGTGYGTDNGIRL
EAVWLTHDPAYPDEQPTAPLARYTYTAGGELRAVYDRSGTQVRGFTYDAEHAGRMVAHHY
AGRPESCYRYDDTGRVTEQVNPEGLDYRFEYGESRVIITDSLNRREVLYTEGEGGLKRVV
KKEHADGSITRSEYDEAGRLKAQTDAAGRRTEYSLHMASGAVTAVTGPDGRTVRYGYNSQ
RQVTSVTYPDGLRSSREYDEKGRLTAETSRSGETTRYSYDDPASELPTGIQDATGSTKQM
AWSRYGQLLAFTDCSGYTTRYEYDRYGQQIAVHREEGISTYSSYNPRGQLVSQKDAQGRE
IRYEYSAAGDLTATISPDGKRSTIEYDKRGRPVSVTEGGLTRSMGYDAAGRITVLTNENG
SQSTFRYDPVDRLTEQRGFDGRTQRYHYDLTGKLTQSEDEGLITLWHYDASDRITHRTVN
GDPAEQWQYDEHGWLTTLSHTCEGHRVSVHYGYDDKGRLTGERQTVENPETGEMLWEHET
GHAYSEQGLATRQEPDGLPPVEWLTYGSGYLAGMKLGGTPLVEYTRDRLHRETARSFGGA
GSTAGYEQATAYTLTGQLQSRHLNLPQLDCDYTWNDNGQLVRISGPQECREYRYSGTGRL
TGVHTTAANLDIDIPYATDPAGNRLPDPELHPDSTLTAWPDNRIAEDAHYVYRYDEYGRL
AEKTDRIPEGVIRMHDERTHHYHYDSQHRLVFYTRIQHGEPQVESRYLYDPLGRRTGKRV
WRRERDLTGWMSLSRKPEETWYGWDGDRLTTVQTQQTRIQTVYQPGSFTPLLRIETENGE
QAKARHRSLAEVLQEDTGVTLPAELAVMLGRLERELRQGSVSEESQQWLAQCGLTAEQMA
AQLEAEYIPERKLHLYHCDHRGLPLALISPEGETAWQGEYDEWGNLLGEESAQHLQQSLR
LPGQQYDEESGLYYNRNRYYDPLQGRYITQDPIGLRGEWNLYKYPLNPVRFIDSLGLKFH
VNGDPSDFNQAVEYLKQDSQMKETIDFLSSSEETINIEYIEGTNVRFNSNNMAIYWNSRA
SLFCSTELNSKSQSPALGLGHEFAHAQYYLLDKENFMALLSRTDKKYENKEEARVITIIE
SRAAKTLGECTRGAHSGLPFYRVDGPLQTMKITGTPE
NT seq 4254 nt   +upstreamnt  +downstreamnt
atgggcggaaaaccggcggcgcggcagggtgatatgacccgcaagggactggatattgtg
cagggttcagcgggggtgctgataggtgcgccgacgggagtggcctgttcggtatgtccg
ggagggattacctatgctaacccggtgaacccgctgctgggtgcgaaggtgctgccgggc
gagacggaccttgcgctgcccggcccgctgccgtttattctttcccgcgcctacagcagc
taccggaccagaacacccgcgccggtgggggtgtttggtcccggctggaaagcgcccttc
gatatccgcttacagatacgcgatgaaggcctgatactcaacgacagcggcggcaggagc
attcactttgagccgctgtttcccggcgagataagctacagccgcagcgagtcactctgg
ctggcgcggggcggagtagcggcgcagcacagttcgcagccgctaagcgcgctctggcag
gtgctgccggaagatgttcgcctgagtccgcatgtgtacctggcgacaaacagccttcag
gggccgtggtggatactcagctggccggagcgggtgccgggggcggacgaggtgctgccg
ccggagccgcccgcataccgggtgctgacgggcgtggtggacggcttcgggcggacgctg
gcctttcaccgggcggcggagggtgatgtggcgggcgcggtgacgggggtgacggacggc
gcgggccgccgttttcacctggtgctgaccacacaggcacagcgggcggaagtattccgt
aaacagcgcgccacgtctttatcttcccctgccggtccccgttctgcttcctcttctctg
gttttccccgacacgctgcccgccggtacaggatacggcacggataacggtatccggctg
gaggcggtatggctgacacacgacccggcatacccggatgaacagccgactgcgccgctg
gcgcgctacacgtacacggccggtggtgaactgcgggcggtgtatgaccgcagcggaacg
caggtgcgcgggtttacttatgatgcggagcacgccgggcggatggtggcgcaccattat
gcggggaggccggagagctgctaccggtatgatgataccggtcgggtgacggagcaggtc
aacccggaggggctggactaccgctttgagtacggagagagccgggtaatcatcacggac
agcctgaaccggcgggaggtgctgtacacggaaggcgagggtggcctgaagcgggtggtg
aagaaggaacatgcggacgggagcattacccgcagcgagtatgatgaggcggggaggctg
aaggcacagacggatgcggcggggcggcggacggagtacagcctgcatatggcgtcgggt
gcggtgacggcggtgacggggccggacggcaggacggtacggtatggctataacagccag
cggcaggtgacgtcggtgacgtacccggacgggcttcgcagcagccgggagtatgatgag
aagggaaggctgacggcggagacctcgcgcagcggtgagacaacgcggtacagctatgat
gacccggcgagtgagctgccgacagggatacaggacgcgacgggcagtacaaaacagatg
gcatggagccgttacggtcaactgctggccttcacggactgctcggggtacacgacgcgg
tatgagtacgaccggtacggtcaacaaatcgccgttcaccgggaggaaggcatcagcact
tacagcagttataacccgcgtgggcaactggtcagtcagaaggatgcgcaggggcgtgaa
atccgttatgagtacagcgccgcaggcgacctgacagcaacgatatcaccggacggtaaa
cgcagcaccatcgaatatgataaacgcgggcgtccggtgagtgtgacggaaggcggtctt
acgcgcagcatggggtatgacgctgccgggcgcatcaccgtgctgaccaacgagaacggc
agccagtccacgttccggtatgacccggtggacaggctgactgaacagcgcggttttgac
ggccggacgcaacgttaccactatgacctgaccggaaaactcacgcagagtgaagacgag
gggcttatcaccctctggcactacgatgcgtcggaccgcatcacgcaccggacggtgaac
ggcgacccggcagagcagtggcagtatgatgagcacgggtggttaaccaccctcagccat
acctgtgaaggccaccgcgtgtcggtccactacggctatgacgataaaggccgcctgacg
ggtgaacggcagacggtggagaacccggagacaggggagatgctgtgggagcatgagacg
gggcatgcgtacagcgaacaggggctggcgacccgtcaggagccggacggtctgccgccg
gtggagtggctgacgtatggcagcggttatcttgcggggatgaagctgggcggaacgccg
ctggtcgagtacacgcgggaccggctgcaccgcgagacggcccgtagcttcggcggggcg
ggcagtacagcggggtacgaacaggccacggcgtacaccctcacagggcagctacagagc
aggcacctgaaccttccgcagcttgactgtgactatacgtggaacgataacggacaactg
gtgcgcatcagcggcccgcaggagtgccgggagtaccgttacagcggcacgggaaggctg
acgggcgtccacactacggcagcgaacctggatatcgatatcccgtatgcgacggacccg
gcaggaaaccggctgccggacccggaactgcacccggacagcaccctcacggcgtggccg
gataaccgcatcgcggaagatgcgcactatgtctaccgctacgatgaatacggcaggctg
gcggagaagacggaccgcatcccggaaggggtgatacggatgcacgacgagcggacccac
cactaccactacgacagccagcaccgtctggtgttctacacgcggatacagcacggtgag
ccgcaggtggagagccgctacctctatgacccgctgggccgccggacgggaaaacgggtg
tggcggcgggagcgtgacctgacggggtggatgtcgctgtcgcgtaaaccggaggagacc
tggtacgggtgggacggtgacaggctgaccactgtacagacccaacagacaagaatccag
acggtataccagccgggaagcttcacgccgctcctgagaatcgaaacagagaatggtgaa
caggcgaaggcgcggcaccgtagcctggcggaggtgttgcaggaggacacgggtgtgacg
ctaccggcggagctggcggtgatgctggggaggctggagcgggaactgcggcagggcagc
gtgagtgaagaaagccagcagtggcttgcgcagtgcgggctgacggcggaacagatggcc
gcgcaactggaggcggaatacatcccggagaggaaacttcatctttaccactgtgaccac
cgtgggctgccgctggcgcttatcagcccggaaggggaaacggcgtggcagggggagtat
gacgagtggggaaacctgctgggcgaggaaagcgcgcagcaccttcagcagtcactccgt
ctgccgggacagcagtatgatgaggagtcggggctgtactacaaccgcaaccggtactat
gatccgttgcaggggagatatatcacccaggacccgatagggctgagaggtgaatggaat
ctgtataaatatccattaaaccctgttcggtttatagattctttgggtttaaaattccat
gttaacggtgatccaagtgattttaatcaggctgttgagtatttaaaacaagattcacaa
atgaaagaaactatagattttttatcaagctctgaagaaactataaatatagagtatatt
gaaggaaccaatgttagatttaattcgaataatatggcgatatattggaatagtagagca
tctttattttgttcaactgaattaaactcgaaatcacaatcgcctgcattaggtttggga
catgagtttgctcatgcgcagtattaccttcttgataaggaaaatttcatggctctttta
agccgaacagataagaaatatgagaataaagaagaggcaagggttattacaataattgaa
tcgcgtgcggcgaaaactttaggtgagtgtaccagaggagctcatagtggactgcctttt
tatcgggtggatggaccgttgcagacgatgaaaataacgggtacgccagaatag

DBGET integrated database retrieval system