KEGG   Escherichia coli O9 HS (commensal): EcHS_A0245
Entry
EcHS_A0245        CDS       T00591                                 

Definition
(GenBank) hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Other DBs
NCBI-ProteinID: ABV04636
Position
267089..267538
AA seq 149 aa
MMKYLMVLLSLFSGSVLGMGRVNELCGIDSVKTIEIINLPSYVTTLVPLSKEGLNEIYRY
KVVVNEISDLYAGKIIDLLQMKYFRKEKYNNIRWGVSIISKGNNKCEIYFDAFGECGSVN
GINVCFEKNEMIGWIKKEIPLLSQKIGGL
NT seq 450 nt   +upstreamnt  +downstreamnt
atgatgaaatatttgatggttttattgtctctattttctggttcggtactggggatgggg
cgagtgaatgaattgtgtggaatagatagcgtgaaaacgatagagataattaatcttcca
tcgtatgttaccacgttagttccgcttagcaaggaaggtcttaatgaaatatacagatat
aaagtggtggtgaatgaaattagcgatctttatgctggtaagataattgatttattgcaa
atgaagtatttcagaaaagaaaaatataacaatataagatggggggttagtatcatttcg
aaaggtaataataaatgtgaaatttattttgatgcttttggtgaatgtggaagtgtgaat
ggcattaacgtgtgttttgaaaaaaatgaaatgataggttggattaaaaaagaaatccct
ttgctgtcgcaaaaaataggtgggctttaa

DBGET integrated database retrieval system