KEGG   Escherichia coli O9 HS (commensal): EcHS_A0247
Entry
EcHS_A0247        CDS       T00591                                 

Definition
(GenBank) hydrolase, carbon-nitrogen family
  KO
K13566  omega-amidase [EC:3.5.1.3]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx00250  Alanine, aspartate and glutamate metabolism
ecx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EcHS_A0247
Enzymes [BR:ecx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.3  omega-amidase
     EcHS_A0247
SSDB
Motif
Pfam: CN_hydrolase
Other DBs
NCBI-ProteinID: ABV04637
Position
complement(268977..269747)
AA seq 256 aa
MPGLKITLLQQPLVWMDGPANLRHFDRQLEGITGRDVIVLPEMFTSGFAMEAAASSLAQN
DVVNWMTAKAQQCNVLIAGSVALQTESGSVNRFLLVEPGGTVHFYDKRHLFRMADEHLHY
KAGNARVIVEWRGWRILPLVCYDLRFPVWSRNLNDYDLAIYVANWPAPRSLHWQALLTAR
AIENQAYVAGCNRVGSDGNGCHYRGDSRVINPQGEIIATADAHQATRIDAELSMVALREY
REKFPAWQDADEFRLR
NT seq 771 nt   +upstreamnt  +downstreamnt
gtgcctggtttgaagattacgcttttgcagcaaccactggtgtggatggatggccctgcc
aacctgcgtcattttgatcgtcaactggaaggtattaccgggcgcgatgtgatcgttcta
ccggagatgtttaccagcggctttgccatggaagcggcagcttcgtcgctagcacaaaat
gacgtagtgaactggatgacagctaaagcgcagcagtgcaatgtgctgattgcaggcagt
gttgcattacaaacggagtctggttcggttaaccgctttttgctggttgagccgggcggc
acggtacatttttatgataagcgtcatctgttccgcatggcagatgagcatctgcattat
aaagcgggcaatgcgcgagtgattgtggaatggcgcggctggcgtattttgccgctggtg
tgctacgacttacgttttcctgtgtggtcgcgcaatctcaacgattatgacctcgccatc
tacgttgccaactggcctgctccgcgctctctgcactggcaggcattgctgacggcccgc
gcgattgagaatcaggcgtatgtggcgggatgcaatcgcgtcggcagcgatggcaacggc
tgccattatcgcggtgacagccgggtgattaacccgcagggcgagattatcgctactgcc
gacgcgcatcaggcaacgcgcattgatgcggagctgtcgatggtggcattgcgggaatat
agagaaaagtttccggcatggcaggatgcggatgagtttaggttgcggtga

DBGET integrated database retrieval system